KEGG   Shewanella baltica OS195: Sbal195_0414Help
Entry
Sbal195_0414      CDS       T00622                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00471  D-Glutamine and D-glutamate metabolism
sbn00550  Peptidoglycan biosynthesis
sbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sbal195_0414
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal195_0414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
    Sbal195_0414
Enzymes [BR:sbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Sbal195_0414
Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal195_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABX47595
UniProt: A9KY30
LinkDB All DBs
Position
471661..473127
Genome map
AA seq 488 aa AA seqDB search
MTKTERYAQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGYQVSGSDIAQNAVTDR
LCLLGAKIQIGHAAENVQQVDVVVVSTAINLENPEILAAKELRIPIVRRAEMLAELMRYR
HGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSAGTNARLGTSRYLIAEADESD
ASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNLPFYGVAVVCIDDAVVREI
MPRIGRQLVTYGFSDDADVQALNFSQQGHQCRFTVRRKGKADLDLVLNLPGQHNVLNALA
AIAVATEDEIDDSAITQALVEFQGIGRRFQHLGKFATPKGEVMLVDDYGHHPSEVAATIK
AARAGWPDKRLVMAYQPHRYTRTRDLYEDFVEVLSQVDCLLLLDVYSAGEAPITGADGRA
LCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLTQGAGNIGALSRLLATTELGFAV
AELPAQAS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacagaaagatacgcacaactgagaagcatgatcccagaaatgcgccgtatt
aagcgtattcacttcgtcggcattggcggcgcgggcatgggcgggatcgccgaagtgtta
gtgaacgaaggctatcaggtgagtggttcggatatcgcgcaaaatgccgtgaccgacaga
ttgtgtttgctcggtgccaagatccaaattggtcatgccgccgaaaacgtgcagcaagtg
gatgtggtcgtggtctccacggcgattaatctggaaaacccagaaatccttgccgctaaa
gaattacgtattcctattgtgcgccgcgccgaaatgctagccgagttgatgcgttatcga
catggtgtggcaattgcgggcacccatggtaaaaccacgacaacgagccttatcgccagc
gtgtacggtcaagcagggcgggatccaaccttcgtgattggtggcttgctcaatagcgcc
ggtaccaacgccagattaggcaccagccgttacttgattgccgaagccgatgagagtgat
gcgagcttcctgcatttgcagcctatggtcagtgtggtgactaacattgaagccgatcac
atggatacctatggcggtgatttcgagaaattgaaatcgaccttcgtggatttcctacat
aacttgccgttttacggtgtcgcagttgtgtgtatcgacgatgctgtggtgcgtgaaatc
atgccgcggattggtcgtcaactcgtgacctatggttttagtgacgatgcggacgtgcaa
gcgctgaatttcagtcagcaagggcatcagtgtcgtttcacggtgagacgtaaaggcaaa
gcggatctcgatctggtgcttaacttgccgggtcaacataacgtgcttaatgccttagct
gcgatagcggtcgcgaccgaagatgaaatcgacgacagcgccattactcaggcgttagtg
gagttccaaggtataggtcgtcgtttccagcatttgggcaagtttgctacgcccaagggc
gaagttatgttggtcgatgattatggccatcaccccagtgaagttgccgcgaccattaaa
gctgcccgtgcaggttggcccgacaagcgtctggttatggcgtatcagccacacagatac
acccgtacccgtgatttgtatgaagactttgttgaagtgttatcccaagtggattgttta
ctgttgctcgatgtttatagtgcgggtgaagcgccgatcactggtgccgatggccgagcc
ttatgtcgctcaattcgcctgcgtggccagttagatccgatctttatcgccagtcctgat
cagctcgcagaggtattgcccgatgtattgcaagagggggatttattactcacccaaggt
gcgggtaatattggcgccctgtcgcgattgttagcgacgacagaattgggctttgccgtt
gcggaattacctgcgcaagcaagctga

DBGET integrated database retrieval system