KEGG   Shewanella baltica OS195: Sbal195_1819
Entry
Sbal195_1819      CDS       T00622                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sbn  Shewanella baltica OS195
Brite
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sbal195_1819
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ABX48990
UniProt: A9KY84
LinkDB
Position
complement(2183944..2184528)
AA seq 194 aa
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEDIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTLAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacttatgttgttaagctaaac
ggcttaatcgaaggaactgatttcgctggtaaatctttagaagatatcatcaaaacttct
actggcggcgtattcaacaacgcagctcaagtgtggaaccacactttctactggaactgc
ctagcaccaaacgctggcggcgagccaacaggcccagttgctgatgcaatcaatgctgct
ttcggttcattcgacgcattcaaagcacaatttactgattcagcagtaaacaacttcggt
agcgcttggacatggttagtgaaaaaagccgatggcacacttgctatcgtcaacactagc
aatgctgcaacgccactgactgacagctcagtaacgccaatcatgacagttgacgtgtgg
gaacacgcttactacatcgattaccgtaacgtgcgtcctgactaccttgcccacttctgg
caattagttaactgggacttcgttaaccaaaacttcgctggttaa

DBGET integrated database retrieval system