KEGG   Shewanella baltica OS195: Sbal195_2090Help
Entry
Sbal195_2090      CDS       T00622                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00473  D-Alanine metabolism
sbn00550  Peptidoglycan biosynthesis
sbn01100  Metabolic pathways
sbn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal195_2090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal195_2090
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Sbal195_2090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
    Sbal195_2090
Enzymes [BR:sbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal195_2090
Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal195_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABX49259
UniProt: A9L0H9
LinkDB All DBs
Position
complement(2490116..2491129)
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDCEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctacttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgactgtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagtaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccgtatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagcagcattggcacaatggggatcg
atcttcgttaaagcggcctcgcagggttcctctgtcggttgttacaaagtggatgacagc
gataaagttgcaggcgtgcttaaggatgcgtttggctatgcaccctatgtgatcgttgaa
aaaaccataaaagcccgcgagttagaagtagccgtctacgagtacaatggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcgcagcatgtgtcagctgagatc
agtgaacaaatccgcgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcactta
tcgcgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatact
ttcccaggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcacgac
tttactgaatacttgagtctagtgattaacggtcagctaaccgctaaatcttag

DBGET integrated database retrieval system