KEGG   Shewanella baltica OS195: Sbal195_3453Help
Entry
Sbal195_3453      CDS       T00622                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00550  Peptidoglycan biosynthesis
sbn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal195_3453
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sbal195_3453
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
    Sbal195_3453
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sbal195_3453
Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Sbal195_3453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABX50615
UniProt: A9L007
LinkDB All DBs
Position
4072193..4074049
Genome map
AA seq 618 aa AA seqDB search
MSPKKRITMHDHAAEASLFKRRALFTFFCVFALLSVLVTNLYHLQVESYKDYETRSNDNR
IRVVPIAPSRGLIYDRNGVLLAENLPFYSLDLVPEKISNMSETLDELGKLIEISEDERET
FTEALKFHRRFKPLTLKNQLTEEQVAIFSVNQHKFPGISVEAGLKRNYPYGAQITHVLGY
VGKINTRDRAQLERSDLWKNYAATKDIGKQGIEKFYESLLHGKPGHLEEEVNNRGRAIRT
LKIVPPEPGQDIYLTLDLKLQQKAVELLTGLRGSIVAIDPRDGGVLAMVSSPSYDPNQFV
QGINNKDYSALLNDKSRPLINRATQGQYAPASTIKPHLALLGLDEKVITESTRVWDPGFW
QIPGVERKYRDWRRWGHGWVNVYSAITESCDTFFYELAYKVGVDHIARFMEQFGFGQNTG
IDIFEESSGNMPSKEWKRLKYNQAWYIGDTISVGIGQGYWTATPLQLANAVGIMANKGRR
FPPHLLKSIKDNTAKIDSPINELPPIELNSPRNWNIINEAMRQTANKSRFTDATYTAAMK
TGTAQVIGVAENTKYDASKIAEHFRDNALVVAYAPFEDPKIVLAVVMENAGWGGANAGPV
ARAMLDEYMLRDTWKPQP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccaaaaaagcggataacaatgcatgatcacgccgccgaggcgtctctttttaag
cgccgagcgctattcacctttttttgcgttttcgccctattaagcgtgttagtcaccaac
ctttatcatttacaggttgaatcctataaggattatgaaactcgctcgaatgataaccgt
atccgcgttgtcccaatagctcctagccgtggtctcatttacgatcgtaacggcgtacta
ttagctgaaaacttacccttctattccctcgatctagttcccgaaaaaatcagcaacatg
tcagagaccctagatgagctcggcaagttaattgagatcagtgaggatgagcgcgaaacc
tttaccgaagcgctgaaatttcatcgccgcttcaagccactgacgctgaaaaaccagctc
accgaagagcaagtggcgattttcagtgttaaccaacataaatttccaggcatttcagtc
gaagcgggtctgaagcgtaactacccctacggcgcgcaaatcacccatgtactgggttat
gtcggcaagattaacacccgagatcgcgcccagttagagcgcagcgatctgtggaaaaac
tatgctgctaccaaggacattggtaagcaaggcattgaaaaattttatgaatccctactg
catggcaaaccgggtcacttagaagaagaagtgaacaaccgcggccgcgcgattcgcacc
ttaaaaattgtgccgccagagccggggcaagatatttacctgacattagatctcaagctg
cagcaaaaagcagttgagctactcacaggtctgcgcggttctattgttgcaatcgatccc
cgtgacggtggcgttttagctatggtatcgagcccaagctatgatccaaaccaatttgtg
caagggattaataacaaagattacagcgccttactcaacgataaatcacgcccgttgatc
aaccgcgcgacccaaggccaatatgcgccagcatcaaccatcaagccccatctcgcactc
ttaggtttagatgaaaaagtcattaccgagagcacccgtgtgtgggaccctggtttttgg
caaattcccggtgtcgaacgtaagtaccgtgactggagacgctggggacacggctgggtt
aacgtttacagtgccattaccgaatcctgcgataccttcttctacgaactcgcctacaaa
gttggggtagaccatattgcccgttttatggagcaatttggctttggtcaaaataccgga
atcgatatctttgaagaatcttctggcaacatgccatccaaagaatggaaacgcttaaag
tacaatcaagcttggtacataggcgataccatttccgtcggtattggccaaggttattgg
actgcaaccccattacaactggcgaatgccgttgggatcatggctaacaaaggccgtcgt
tttccgccgcatctgctgaagtccattaaagacaatacggccaagattgactcaccgatt
aatgagttgccacccattgagcttaatagtccccgtaactggaatatcatcaacgaagcg
atgcgccagacggcgaataaatcacgctttaccgatgccacttacaccgccgcgatgaaa
accggtacggcgcaggttattggcgtagcagaaaataccaaatacgatgcgagtaaaatt
gccgaacatttccgcgataatgccttagttgtggcctatgcgcccttcgaagatcctaaa
atcgtcctcgccgtcgtgatggaaaacgctggttggggtggcgcaaatgctggccctgtc
gctcgcgccatgctcgatgaatatatgcttagagatacttggaaaccgcaaccatga

DBGET integrated database retrieval system