KEGG   Shewanella baltica OS195: Sbal195_3457Help
Entry
Sbal195_3457      CDS       T00622                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00550  Peptidoglycan biosynthesis
sbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal195_3457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbn01002]
    Sbal195_3457
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
    Sbal195_3457
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sbal195_3457
Peptidases and inhibitors [BR:sbn01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Sbal195_3457
Peptidoglycan biosynthesis and degradation proteins [BR:sbn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sbal195_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABX50619
UniProt: A9L011
LinkDB All DBs
Position
4077198..4078373
Genome map
AA seq 391 aa AA seqDB search
MMNFVKSPIKTLLLISSASLPVYAAQPIITPDAPSVAAKAFVLMDYNSGQIIAESNAYES
LNPASLTKMMTSYVIGQEIKAGNVSVDDDVTISKNAWSKNFSDSSKMFIEVGTTVKVGDL
NRGIIIQSGNDACVAMAEHIAGTEGAFVDMMNSWAKQLGMRDSYFENAHGLDAENHKSTA
YDMALLGAALIRDVPDEYHIYSEKFYTFNGIKQYNRNGLLWDNSMNVDGIKTGHTSGAGY
NLVASATKDGMRLISVVMGTQSESARKAESKKLLTYGFRFFETVTPYKAGDSFITQQIWY
GDKSTVDLGVATDTPITISRGRGKDLKANFELTKPLDAPLKKGETVGRLFFQLDGKDIAQ
FPLVTLQEVNEGSWFSKLVDYFKQMFSGWFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattttgtaaaaagtcccattaaaacattgctgctaatttccagtgcctctctc
cccgtttatgctgcgcagcctattattacacctgatgcaccttcagtagccgccaaggcg
ttcgtattgatggattataattcgggtcagattatcgctgaaagtaacgcttatgaaagc
cttaacccagccagtttaactaagatgatgaccagttacgtgatcggtcaagaaatcaaa
gcgggcaatgtctccgttgatgatgatgtgactatcagtaaaaatgcttggtctaaaaac
ttctcagactcttctaagatgttcattgaagtaggcactacggttaaagtgggcgatcta
aaccgcggtatcatcattcaatcgggtaacgatgcgtgtgtggcgatggccgagcacatt
gccggtactgaaggcgccttcgttgacatgatgaactcatgggcgaagcaactggggatg
cgtgatagctacttcgaaaacgcccacggtttagatgcagaaaaccacaaatcaaccgcc
tatgatatggcattactgggcgcagcgttaatccgcgacgtgccagatgaataccacatc
tatagcgaaaaattctatacattcaatggtatcaaacaatacaaccgtaatggtttattg
tgggataacagcatgaacgtggacggtatcaaaaccggtcacacctcaggtgcgggctac
aacttagtggcatcggcaaccaaagacggcatgcgtttaatttcagtggtgatgggcact
caaagtgaatcagcccgtaaagctgaaagtaagaaattactgacctatggcttccgtttc
ttcgaaacagtaacaccatacaaggcgggtgatagctttatcactcagcaaatttggtac
ggtgacaagagcacggttgatttaggcgtggcaactgacacacctatcaccatcagccgt
ggccgtggtaaagacttgaaagcaaacttcgagctgactaaaccattagatgcaccgttg
aaaaaaggtgaaactgttggccgtctattcttccaacttgatggtaaagacattgcccag
ttcccactggtgacgttgcaagaagtcaacgaaggcagctggtttagtaaattagttgat
tactttaagcagatgttttctggatggtttagctaa

DBGET integrated database retrieval system