KEGG   Shewanella baltica OS195: Sbal195_3639Help
Entry
Sbal195_3639      CDS       T00622                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbn  Shewanella baltica OS195
Brite
KEGG Orthology (KO) [BR:sbn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sbal195_3639
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sbal195_3639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_7 Glutaredoxin Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABX50801
UniProt: A9L1K5
LinkDB All DBs
Position
4289152..4290738
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERT
PAMTVINPQLNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVANRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIIVDARGQTSIPGVFAA
GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagcttagcg
caagacattgtcagcctatcttctctggtgagcctgaaagaaactcagggcgaacgcacc
cctgcgatgacagtgataaacccacaacttaatacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcacttgtgttggccttactgcacacgggtggacacccaatc
aaactcagcgatgacattatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttacgtctcactgacctgccaaaactgcccagacgtagtacaggcactgaacatgatg
gcggcgattaacccgaatatcaccaacgtgatgatcgacggcgccctgttccaagacgaa
gtggcgaaccgtaacattatggccgtgccttctgtctacttaaatggcgaagtgtttgca
gccggtcgtatcagcattggcgagatcctcaataaactggacaccaatgccgcaagccgc
aaggccgatgaaattaatgaaaaagcgccattcgaagtcttagtggtaggcggcggccca
gcgggcgcagcggcagctatttatgcagcacgtaaaggccttcgcactggtattgttgcc
gataagtttggcggccaagtggctgaaaccgttggtatcgagaactttatttcggtcaaa
gcgaccgaaggtccaaagctagtggcaaaccttgaagcccatgtacgagactacgaagtc
gacatcatggacaaccaaaaggcagtgtcgttatcaacagatggcttgttcgagcttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgttagccacaggtgcacgctgg
cgagaaatgaacgtccccggcgagaaagaataccgtggtaaaggtgtcgcatactgcccg
cattgcgatggcccgttatttaaaggcaagcgtgtggcggtgattggcggcggtaactca
ggtatcgaagcggctatcgatctcgccaacatagtagaacatgtgactgtgctggagttt
gataaaaccctacgcgccgacgatgtgctacaacgtaaagcagcgtctatgggtaacatc
aaaattattacccaagccatgaccacagaagtgactggcgatggtactcgggttaatggc
ctgaactacacagacagagcaacaggcgagagtcaccatgtcgcacttgcaggtatcttc
gtacagattgggctagtgccgaataccgagtggctaaaaggtgtggttgaactgacgcca
cgtggggaaatcattgtcgatgcccgcggtcaaacatccatccctggagtatttgcggca
ggcgatgtcactgacacgccgtttaagcaaattatcatcgccatgggcagcggcgcgagt
gcatcactgggcgcatttgattacctaattcgccacagcgatgaagaaatcgccgaaacg
aaaaccacagacacgaaagcggcctaa

DBGET integrated database retrieval system