KEGG   Shewanella baltica OS195: Sbal195_3752Help
Entry
Sbal195_3752      CDS       T00622                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal195_3752
Enzymes [BR:sbn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sbal195_3752
Transporters [BR:sbn02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sbal195_3752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABX50912
UniProt: A9L2E9
LinkDB All DBs
Position
complement(4419181..4419813)
Genome map
AA seq 210 aa AA seqDB search
MITLYGTPRSRALRVAWVLEELGVDWDFSFVDMTKGAHRSAAFLAINPCGKVPVLTDDEL
VLSESAAICLYLAEKYGGGKLLPPAGSNASGLHHQWVSFIITELEQPLWTLGKHKFALPE
EQRHPQIMPCAVWEFDKAAALAEAMLPESDFLLGDDVSVADILLAHTLMWGTLFEQAIPP
KLAAYRDRLSALPSRQSALQKMDAVVAAKG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttatatggcacaccgcgcagtcgcgcattacgagttgcttgggtgttggaa
gagttgggcgttgattgggatttttcctttgtggatatgaccaaaggtgcgcatcgcagc
gcggcatttttagcgataaacccctgcggtaaagtgcctgtgctaactgatgatgagcta
gtgttatccgaatctgcggcgatttgcctttatctagcagaaaagtatggcgggggtaag
ttgttgccacccgcggggagtaacgcatcgggtttgcaccatcaatgggtgagcttcatc
attactgagcttgagcagccgctttggactttgggtaagcataagtttgctttaccggag
gagcagcgtcatccgcagatcatgccttgtgcggtatgggagtttgataaggcggctgca
ttggccgaagccatgttgcctgaaagtgattttttgctcggtgatgacgtttcggtggcg
gatattttattggcccataccttaatgtggggcacattgtttgaacaagccattccacct
aaactcgccgcttatcgcgataggttgtctgcgctgccgtcgcgtcaatcggctttgcag
aagatggatgctgtggtggctgctaagggttaa

DBGET integrated database retrieval system