KEGG   Shigella boydii Sb227 (serotype 4): SBO_0278Help
Entry
SBO_0278          CDS       T00301                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00730  Thiamine metabolism
sbo00790  Folate biosynthesis
sbo01100  Metabolic pathways
sbo02020  Two-component system
Module
sbo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SBO_0278 (phoA)
   00790 Folate biosynthesis
    SBO_0278 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SBO_0278 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbo04147]
    SBO_0278 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbo00537]
    SBO_0278 (phoA)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SBO_0278 (phoA)
Exosome [BR:sbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBO_0278 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbo00537]
 Enzymes
  SBO_0278 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ABB64993
ShiBASE_China: SBO0278
UniProt: Q325L5
LinkDB All DBs
Position
290848..292332
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQ
IVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgtttaacgggtgatcagactgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattacagccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaa
ccggactacgtcaccgattcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaatgctcgtgccgacgttacgcttggcggtggcgcaaaaacctttgctgaaacggca
accgccggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtcagcgatgccgcctcgctaaatgcggtgacggaagcgaatcagcaaaaacctctg
cttggactgtttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtac
cacggcaatatcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagt
gtaccaaccctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggatttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatcct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
attgtcgcgccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggc
gcagtgatggtgatgagctacgggaactccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggcccgcatgccgccaatgtcgttggactgaccgaccag
accgatctcttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system