KEGG   Shigella boydii Sb227 (serotype 4): SBO_0471Help
Entry
SBO_0471          CDS       T00301                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SBO_0471 (ahpF)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SBO_0471 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABB65173
ShiBASE_China: SBO0471
UniProt: Q324T5
LinkDB All DBs
Position
490168..491763
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaacatgctcgacacaaatatgaaaactcaactc
aaggcttaccttgagaaattgaccaagcctgttgagttaattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgttggctgaaatcgcagaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcaccaaccca
ggttccaaccaggggccacgttttgcaggctccccgctgggccacgagttcacctcgctg
gtactggcgttgctgtggaccggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgccatattgacggtgattttgaattcgaaacctattactcgctctcttgccat
aactgcccggacgtggtgcaggcgctgaacctgatgagcgtactgaacccgcgcatcaag
cacactgcaattgacggcggcaccttccagaacgaaatcaccgatcgcaacgtgatgggc
gttccggcagtgttcgtaaacgggaaagagtttggtcagggccgcatgacgttgactgaa
atcgttgccaaaattgatacgggcgcggaaaaacgtgcggcagaagagctgaacaagcgt
gatgcttatgacgtattaatcgtcggttccggcccggcgggtgcagcggcagcaatttac
tccgcacgtaaaggcatccgtaccggtctgatgggcgaacgttttggtggtcagatcctc
gataccgttgatatcgaaaactacatttctgtaccgaagactgaagggcagaagctggca
ggcgcactgaaagttcacgttgatgaatacgacgttgatgtgatcgacagccagagcgcc
agcaaactgatcccagcagcagttgaaggtggtctgcatcagattgaaacagcttctggc
gcggtactgaaagcacgcagcattatcgtggcgaccggtgcaaaatggcgcaacatgaac
gttccgggcgaagatcagtatcgcaccaaaggcgtgacctactgcccgcactgcgacggc
ccgctgtttaaaggtaaacgcgtagcggttatcggcggcggtaactccggcgtggaagcg
gcaattgacctggcgggtatcgttgagcacgtaacgctgctggaatttgcgccagaaatg
aaagccgaccaggttctgcaggacaaactgcgcagcctgaaaaacgtcgacattattctg
aatgcgcaaaccacggaagtgaaaggcgacggcagcaaagtcgttggtctggaatatcga
gatcgtgtcagcggcgatattcacaacatcgaactggccggtattttcgtgcagattggt
ctgctgccgaacaccaactggctcgaaggcgcagtcgaacgtaaccgcatgggtgagatt
atcattgatgcgaaatgcgaaaccaacgtcaaaggcgtattcgcagcgggtgactgtacg
acggttccgtacaagcagatcatcatcgccactggcgaaggtgccaaagcctctctgagt
gcttttgactacctgattcgcaccaaaactgcataa

DBGET integrated database retrieval system