KEGG   Shigella boydii Sb227 (serotype 4): SBO_0581Help
Entry
SBO_0581          CDS       T00301                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00020  Citrate cycle (TCA cycle)
sbo00190  Oxidative phosphorylation
sbo00650  Butanoate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
Module
sbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBO_0581 (sdhA)
   00650 Butanoate metabolism
    SBO_0581 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBO_0581 (sdhA)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBO_0581 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SBO_0581 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ABB65269
ShiBASE_China: SBO0581
UniProt: Q324I9
LinkDB All DBs
Position
599721..601487
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtaaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtcttgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcggcggctgaccgt
accggtcacgcactgttgcacacgctttatcagcagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaagaaccaggatggcgcggtggtgggttgt
actgcactgtgcatcgaaactggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggggcagggcgtatttatcagtccaccactaacgcccacattaacactggc
gacggcgtcggcatggctatccgcgcaggcgtaccggtgcaggatatggaaatgtggcag
ttccacccgaccggtattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgaccacctgggtaaa
gaagttctcgaatcccgtctgccgggcatcctggaactctcccgtaccttcgctcacgtc
gatccggtgaaagagccgatcccggttatcccaacctgtcattacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgactgtgaatgagaaaggcgaagatgtggttgtt
ccgggactgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgtgcggcaggtctgcatctgcaa
gagtctatcgccgagcagggcgcattgcgcgatgccagcgagtctgatgttgaagcatct
ctggatcgtctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgattcgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagttatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system