KEGG   Shigella boydii Sb227 (serotype 4): SBO_0582Help
Entry
SBO_0582          CDS       T00301                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00020  Citrate cycle (TCA cycle)
sbo00190  Oxidative phosphorylation
sbo00650  Butanoate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
Module
sbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBO_0582 (sdhB)
   00650 Butanoate metabolism
    SBO_0582 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBO_0582 (sdhB)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBO_0582 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SBO_0582 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ABB65270
ShiBASE_China: SBO0582
UniProt: Q324I8
LinkDB All DBs
Position
601503..602219
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgtcgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagcgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system