KEGG   Shigella boydii Sb227 (serotype 4): SBO_0653Help
Entry
SBO_0653          CDS       T00301                                 

Gene name
ipaH_1
Definition
(GenBank) invasion plasmid antigen
Organism
sbo  Shigella boydii Sb227 (serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NEL TTSSLRR LRR_4 Big_4
Motif
Other DBs
NCBI-ProteinID: ABB65333
ShiBASE_China: SBO0653
UniProt: Q324C5
LinkDB All DBs
Position
complement(664012..665838)
Genome map
AA seq 608 aa AA seqDB search
MREINMLRNISSCLFPHISKITSPNHYLSEWDDWEKQGLPEEQRTEAVRRLRACLTSKGH
KLDLRALALSSLPVLPACIKKLDVSCNKLTILTDLPENIKELIARDNFLTHISALPHYLI
TLDVSENQLENLPLLPDTIKSLSAEYNRLSTLPSLPLNLKKLEVRNNELQTLPSLPSNLK
ILKVAHNHLTELPPLPRRLQLLFAYSNRLSNLPNIQENIIMRRFFYFENNQITTIPTNLF
RLDPHITIEIANNPLSDQTLLFLIQQTSVPNFNGPQFRISLSDQNRLFLRQMLPQNLHSR
HIRVITEGGQNFQIPPLPETVAAWFPEADRREVSTQWTSFSTEENSRAFSAFLDRLSDTV
SARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQA
SEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLST
AVKEMRFYGVSGVTANDLRTAEAMVRSREENEFKDWFSLWGPWHAVLKRTEADRWALAEE
QKYEMLENEYPQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRLPE
NGSQLHHS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaattaatatgctcagaaatatttcatcctgtttatttccacatatcagcaaa
attacatcccccaaccattatttgtccgaatgggatgattgggagaaacaggggttaccg
gaagaacagcgtactgaggcggtaagaagacttcgtgcatgtcttacctctaaggggcat
aaactggacctgcgagccttggcgctttcctcgttacctgtactccctgcttgcattaaa
aagcttgatgtgagctgtaataaattaaccatccttactgatttacctgaaaatattaaa
gaacttattgcaagagataatttcttaacacatatatctgcattaccacattatctaata
actttggatgtgtccgaaaatcaattagagaatctgccgttattaccagacaccatcaaa
tcactaagcgcagagtataataggttatccacactgccttcattacccttgaatttaaaa
aaacttgaggttaggaacaacgaactgcaaactcttccatctctgccttctaatcttaag
atacttaaggttgcgcacaaccatcttactgaactgccccctttacctaggagactgcaa
cttctttttgcatatagcaatagattaagcaacttaccaaacatccaagaaaatattatc
atgagaagatttttttattttgaaaacaaccaaataactacaatcccgacaaatcttttt
cgtttagatcctcatataactattgagattgcaaataaccccttatcagatcaaactctg
ctattcttaatacagcaaacttcggttccaaattttaacgggcctcagtttcgtatttcc
ctgtcagaccaaaacagactgtttttacgccagatgttgccgcaaaatttacattcgcgc
catatcagagtcatcactgaaggggggcagaactttcagatcccccctcttcccgaaact
gtggcagcctggtttcctgaagcagatcgtcgggaggtttctacacaatggacttctttt
tccaccgaggagaattcccgggcattctccgcgttccttgaccgcctttccgataccgtc
tctgcacgcaatacctccggattccgtgaacaggtcgctgcatggctggaaaaactcagt
gcctctgcggagcttcgacagcagtctttcgctgttgctgctgatgccactgagagctgt
gaggaccgtgtcgcgctcacatggaacaatctccggaaaaccctcctggtccatcaggca
tcagaaggccttttcgataatgataccggcgctctgctctccctgggcagggaaatgttc
cgcctcgaaattctggaggacattgcccgggataaagtcagaactctccattttgtggat
gagatagaagtctacctggccttccagaccatgctcgcagagaaacttcagctctccact
gccgtgaaggaaatgcgtttctatggcgtgtcgggagtgacagcaaatgacctccgcact
gccgaagccatggtcagaagccgtgaagagaatgaatttaaggactggttctccctctgg
ggaccatggcatgctgtactgaagcgtacggaagctgaccgctgggcgctggcagaagag
cagaaatatgagatgctggagaatgagtaccctcagagggtcgctgaccggctgaaagca
tcaggtctgagcggtgatgcggatgcggagagggaagccggtgcacaggtgatgcgtgag
actgaacagcagatttaccgtcagctgactgacgaggtactggccctgcgattgcctgaa
aacggctcacaactgcaccattcataa

DBGET integrated database retrieval system