KEGG   Shigella boydii Sb227 (serotype 4): SBO_0912
Entry
SBO_0912          CDS       T00301                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00052  Galactose metabolism
sbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SBO_0912 (gatD)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SBO_0912 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 3HCDH_N Shikimate_DH 2-Hacid_dh_C UDPG_MGDP_dh_N PrmA Methyltransf_25 FAD_binding_2 ELFV_dehydrog MTS Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: ABB65578
ShiBASE_China: SBO0912
UniProt: Q323D0
LinkDB
Position
complement(942015..943055)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGSMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFTQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggatttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgagccgattaccgttggtctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggctattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggttcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgttttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactattccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcacccaggcggtgcgtgacatcgctcgtaatgccatgccgggc
aaagtgttgctcattccatga

DBGET integrated database retrieval system