KEGG   Shigella boydii Sb227: SBO_1454Help
Entry
SBO_1454          CDS       T00301                                 

Gene name
pykF
Definition
(GenBank) pyruvate kinase I
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00010  Glycolysis / Gluconeogenesis
sbo00230  Purine metabolism
sbo00620  Pyruvate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
sbo01230  Biosynthesis of amino acids
Module
sbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbo_M00002  Glycolysis, core module involving three-carbon compounds
sbo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sbo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_1454 (pykF)
   00620 Pyruvate metabolism
    SBO_1454 (pykF)
  Nucleotide metabolism
   00230 Purine metabolism
    SBO_1454 (pykF)
Enzymes [BR:sbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SBO_1454 (pykF)
Membrane trafficking [BR:sbo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SBO_1454 (pykF)
Exosome [BR:sbo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SBO_1454 (pykF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI DUF4115 DUF4651
Motif
Other DBs
NCBI-ProteinID: ABB66073
ShiBASE_China: SBO1454
UniProt: Q321D5
LinkDB All DBs
Position
complement(1431185..1432597)
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKT
AAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVG
NTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIF
GCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKLRITEAVCR
GAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLV
KEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccaaaattgtttgcaccatcggaccgaaaaccgaatctgaagagatgtta
gctaaaatgctggacgctggcatgaacgttatgcgtctgaacttctctcatggtgactat
gcagaacacggtcagcgcattcagaatctgcgcaacgtgatgagcaaaactggtaaaacc
gccgctatcctgcttgataccaaaggtccggaaatccgcaccatgaaactggaaggcggt
aacgacgtttctctgaaagctggtcagacctttactttcaccactgataaatctgttatc
ggcaacagcgaaatggttgcggtaacgtatgaaggtttcactactgacctgtcagttggc
aacaccgtactggttgacgatggtctgatcggtatggaagttaccgccattgaaggtaac
aaagttatctgtaaagtgctgaacaacggtgacctgggcgaaaacaaaggtgtgaacctg
cctggcgtttccattgctctgccagcactggctgaaaaagacaaacaggacctgatcttt
ggttgcgaacaaggcgtagactttgttgctgcttcctttattcgtaagcgttctgacgtt
atcgaaatccgtgagcacctgaaagcgcacggcggcgaaaacatccacatcatctccaaa
atcgaaaaccaggaaggcctcaacaacttcgacgaaatcctcgaagcctctgacggcatc
atggttgcgcgtggcgacctgggtgtagaaatcccggtagaagaagttatcttcgcccag
aagatgatgatcgaaaaatgtatccgtgcacgtaaagtcgttatcactgcgacccagatg
ctggattccatgatcaaaaacccacgcccgactcgcgcagaagccggtgacgttgcaaac
gccatcctcgacggtactgacgcagtgatgctgtctggtgaatccgcaaaaggtaaatac
ccgctggaagcggtttctatcatggcgaccatctgcgaacgtaccgaccgcgtgatgaac
agccgtctcgagttcaacaatgacaaccgtaaactgcgcattaccgaagcggtatgccgt
ggtgccgttgaaactgctgaaaaactggatgctccgctgatcgtggttgctactcagggc
ggtaaatctgctcgcgcagtacgtaaatacttcccggatgccaccatcctggcactgacc
accaacgaaaaaacggctcatcagttggtactgagcaaaggcgttgtgccgcagctggtt
aaagagatcacttctactgatgatttctaccgtctgggtaaagaactggctctgcagagc
ggtctggcacacaaaggtgacgtcgtagttatggtttctggtgcactggtaccgagcggc
actactaacaccgcatctgttcacgtcctgtaa

DBGET integrated database retrieval system