KEGG   Shigella boydii Sb227 (serotype 4): SBO_1760Help
Entry
SBO_1760          CDS       T00301                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00250  Alanine, aspartate and glutamate metabolism
sbo00410  beta-Alanine metabolism
sbo00640  Propanoate metabolism
sbo00650  Butanoate metabolism
sbo01100  Metabolic pathways
sbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SBO_1760 (goaG)
   00650 Butanoate metabolism
    SBO_1760 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBO_1760 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBO_1760 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbo01007]
    SBO_1760 (goaG)
Enzymes [BR:sbo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SBO_1760 (goaG)
Amino acid related enzymes [BR:sbo01007]
 Aminotransferase (transaminase)
  Class III
   SBO_1760 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABB66361
ShiBASE_China: SBO1760
UniProt: Q31ZZ7
LinkDB All DBs
Position
complement(1735519..1736784)
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggcagaaaacgctacgctgaaggacgtagagggcaac
gaatacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaattgcaacagtttacccacacggcgtatcagattgtg
ccgtacgaaagctacgtcacgctggcggagaaaattaacgcccttgccccagtgagcggg
caggctaaaaccgcattcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgacctggcgtgattgcgtttagcggcggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcggacattgaagcgaagcaggtggcg
gccattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccattccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system