KEGG   Shigella boydii Sb227 (serotype 4): SBO_2379Help
Entry
SBO_2379          CDS       T00301                                 

Definition
(GenBank) putative enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00071  Fatty acid degradation
sbo00280  Valine, leucine and isoleucine degradation
sbo00281  Geraniol degradation
sbo00310  Lysine degradation
sbo00362  Benzoate degradation
sbo00380  Tryptophan metabolism
sbo00410  beta-Alanine metabolism
sbo00640  Propanoate metabolism
sbo00650  Butanoate metabolism
sbo00903  Limonene and pinene degradation
sbo00930  Caprolactam degradation
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
sbo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SBO_2379
   00650 Butanoate metabolism
    SBO_2379
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SBO_2379
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBO_2379
   00310 Lysine degradation
    SBO_2379
   00380 Tryptophan metabolism
    SBO_2379
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBO_2379
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBO_2379
   00281 Geraniol degradation
    SBO_2379
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBO_2379
   00930 Caprolactam degradation
    SBO_2379
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SBO_2379
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SBO_2379
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SBO_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABB66941
ShiBASE_China: SBO2379
UniProt: Q31YB7
LinkDB All DBs
Position
complement(2367340..2369484)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPDEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISA
KPDNFIAGADINMIGNCKTVQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTTLEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEVAVELAKKDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTKGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVSERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccggatgagaaaatgaataccctgaaggcggaatttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgcggcgtggtgtttatctccgcg
aaaccggacaattttatcgccggagcagacatcaacatgatcggcaactgcaaaacggtg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacaacattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattttgctggaagtcgctgttgag
ctggcgaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagcggttatgacgccgaagctcgggcgtttggcgaactggcgatgacgcca
caatcgcaggcgctgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggt
agtgatgcaccgcctgcgccattaaacagcgtgggaattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgggtacatcagcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccaaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggtttctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system