KEGG   Shigella boydii Sb227 (serotype 4): SBO_2394Help
Entry
SBO_2394          CDS       T00301                                 

Gene name
emrK
Definition
(GenBank) multidrug resistance protein K
  KO
K07797  multidrug resistance protein K
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SBO_2394 (emrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl Membrane_bind ORMDL PepSY_TM
Motif
Other DBs
NCBI-ProteinID: ABB66955
ShiBASE_China: SBO2394
UniProt: Q31YA3
LinkDB All DBs
Position
complement(2384108..2385271)
Genome map
AA seq 387 aa AA seqDB search
MEQINSNKKHSNRRKYFSLLAVVLFIAFSGAYVYWSMELEDMISTDDAYVTGNADPISAQ
VSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSA
EVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKAL
VMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVV
PARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQN
ATGNWIKIVQRVPVEVSLDPKELMEHPLRIGLSMTATIDTKNEDIAEMPELASTVTSMPA
YTSKALVIDTSPIEKEISNIISHNGQL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagattaattcaaataaaaaacattctaacagaagaaaatacttttctttattg
gcggtagttttatttattgcgttttcaggtgcctatgtctattggtcaatggaattagaa
gacatgattagtacagatgacgcctatgtcacggggaatgcagatccaatttctgcacaa
gtctcaggtagtgtcactgtcgttaatcataaagatacgaactacgttcgacaaggtgac
attttagtttcactggataaaactgatgccactatcgcactcaataaagctaaaaataat
ctggcaaatattgttcggcaaacgaataaactatacttacaggataaacaatacagtgcc
gaagtcgcttcagcacgtattcagtatcaacaatctttagaagattataaccgtcgagtg
ccgttagcgaagcagggggttatttcaaaagaaacgctggagcataccaaagatacgtta
ataagtagcaaagcggcattgaatgccgctatccaggcttataaagcgaataaagcttta
gtaatgaacacaccattaaaccgtcagccacaagtcgttgaagcggcggatgcaactaaa
gaagcctggttggcgcttaaacgtacggatattaagagtccggttaccggctatattgcc
cagagaagtgttcaggtcggcgaaacagtgagccccggacaatcgttaatggctgtcgta
ccggcacgtcaaatgtgggttaatgccaactttaaagaaacacaactcacggatgtgcgg
attggtcaatcggtcaatattatcagcgatctttatggtgaaaatgttgtgtttcatggt
cgggtgacagggatcaatatgggaaccggcaatgcgttctccttattacctgcacaaaat
gcgacagggaactggatcaaaatcgttcagcgtgtaccggttgaagtttctcttgatcca
aaagaactcatggaacatcccttgcgtattggtttatcgatgacagcaactattgatacg
aagaacgaagacattgccgagatgcctgagctggcttcaaccgtgacctccatgccggct
tataccagtaaggctttagttatcgataccagtccgatagaaaaagaaattagcaacatt
atttcgcataatggacaactttaa

DBGET integrated database retrieval system