KEGG   Shigella boydii Sb227 (serotype 4): SBO_3414Help
Entry
SBO_3414          CDS       T00301                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00564  Glycerophospholipid metabolism
sbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SBO_3414 (glpD)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SBO_3414 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ABB67901
ShiBASE_China: SBO3414
UniProt: Q31VK7
LinkDB All DBs
Position
3404802..3406307
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggctccgcat
atcgccttcccaatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcggattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaggcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgaattttccatcatcggcaccaccgacgtagagtataaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaactatctgctgaaagtgtataacgcgcacttt
aaaaaacagcttagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcagaacatgcgctggaaaaactgacgccgtattatcagggtattggcccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgcgacgattacgcagct
cgtctgcgccgtcgctatccattcctgactgaatcgctggcgcgtcattacgcacgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggggcgataagcgacctcggggag
gatttcggtcatgagttctacgaagcggaactgaaatacctggtggatcacgaatgggtc
cgccgcaccgacgatgccctttggcgtcgcacaaaacaaggcatgtggctgaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system