KEGG   Shigella boydii Sb227 (serotype 4): SBO_3622Help
Entry
SBO_3622          CDS       T00301                                 

Gene name
tdh
Definition
(GenBank) threonine dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00260  Glycine, serine and threonine metabolism
sbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBO_3622 (tdh)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     SBO_3622 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2 Methyltransf_25 Methyltransf_16 MTS Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABB68102
ShiBASE_China: SBO3622
UniProt: Q31V06
LinkDB All DBs
Position
complement(3639105..3640130)
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagagggcatctggatgaccgacgtccctgta
ccggaactcgggcataacgatctgctgattaaaatccgtaaaacagccatctgcgggact
gacgttcacatctataactgggatgagtggtcgcaaaaaaccatcccggtgccgatggtc
gtaggccatgaatatgtcggtgaagtggtaggtattggtcaggaagtgaaaggcttcaaa
atcggcgatcgcgtttctggcgaaggccatatcacctgcggtcactgtcgcaactgtcgt
ggcggtcgtacccatctgtgccgcaacacgatcggcgtcggcgttaaccgtccgggctgc
ttcgccgaatatctggtgatcccggcgttcaacgccttcaaaatcccagacaatatctcc
gacgacctggcttccatttttgatcccttcggtaacgccgtgcataccgcgctgtcgttc
gatctggttggcgaggatgtgctggtctctggtgcaggtccgataggtattatggctgcg
gcggtggcgaaacacgttggtgcacgcaatgtggtgatcactgatgttaacgaataccgc
cttgagctggcgcgcaaaatgggtatcacccgtgcggttaacgtcgcgaaagaaaacctt
aatgatgtgatggctgaactgggcatgaccgaaggctttgatgtcggtctggaaatgtcc
ggtgcgccgccagcgtttcgtaccatgcttgacaccatgaaccacggcggccgtattgcg
atgctgggtattccgccgtctgatatgtctatcgactggaccaaagtgatctttaaaggc
ttgttcattaaaggtatttacggtcgtgagatgtttgaaacctggtacaagatggcggcg
ctgattcagtctggcctcgatctctcgccgatcattacccatcgtttctctatcgatgat
ttccagaagggctttgacgctatgcgttcgggccagtccgggaaagtaattctgagctgg
gattaa

DBGET integrated database retrieval system