KEGG   Shigella boydii Sb227 (serotype 4): SBO_3975Help
Entry
SBO_3975          CDS       T00301                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00620  Pyruvate metabolism
sbo00680  Methane metabolism
sbo01100  Metabolic pathways
sbo01120  Microbial metabolism in diverse environments
sbo01200  Carbon metabolism
Module
sbo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBO_3975 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SBO_3975 (ppc)
Enzymes [BR:sbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SBO_3975 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABB68426
ShiBASE_China: SBO3975
UniProt: Q31U32
LinkDB All DBs
Position
complement(4009280..4011931)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEAPPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYKS
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIRTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDVYRGYVRENKDFVPYLRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtccaaatcttcacgcgctggcaatgatgctaaccgccaggagttactcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcaccctacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgcttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttaatcgcccagtcatggcataccgatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtggaaaacagcctgtggcaaggcgtaccaaattac
ctgcgcgaactgaacgaacaactggaagagaacctcggctacaaactgcccgtcgaattt
gttccggtccgttttacttcgtggatgggcggcgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctactcagccgctggaaagccaccgatttgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgccccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggcctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtccgtattgatatccgtcaggagagcacc
cgccataccgaagcgctgggcgagctgacccgctacctcggtatcggcgactacaaaagc
tggtcagaggccgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctt
ctgccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcgccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtactggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaaccctcgatgacctgaacaacgccaacgatgtcatgacccag
ctgctcaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggcgtgatggcagcgtcctgggcgcaatatcaggca
caggatgcattaatcagaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggtgcacctgcccatgcggcactgctgtcacaaccg
ccaggaagcctgaaaggcggcctgcgcgtaaccgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctttataccggggcgattctggaa
gccaacctgctgccaccgccggagccgaaagagagctggcgtcgcattatggatgaactg
tcagtcatctcctgcgatgtctaccgcggctacgtacgtgaaaacaaagattttgtgcct
tacttgcgctccgctacgccggaacaagaactgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactacgcgccattccgtggatcttcgcc
tggacgcaaaaccgtctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gtggtcgaagacggcaaacagagcgagctggaggctatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgaccaacgcctggtagacaaagcactgtggccgttaggtaaagagttacgcaat
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaggccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgaacaagcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system