KEGG   Shigella boydii Sb227 (serotype 4): SBO_P149
Entry
SBO_P149          CDS       T00301                                 

Gene name
icsP_sopA
Definition
(GenBank) IcsP (SopA)
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SBO_P149 (icsP_sopA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbo01002]
    SBO_P149 (icsP_sopA)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     SBO_P149 (icsP_sopA)
Peptidases and inhibitors [BR:sbo01002]
 Aspartic peptidases
  Family A26: omptin family
   SBO_P149 (icsP_sopA)
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-ProteinID: ABB69021
ShiBASE_China: SBOP149
UniProt: Q31SD7
LinkDB
Position
pSB4_227:125379..126326
AA seq 315 aa
MKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERVYHPKEGGRKIS
QLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNSNTPQVWTDQSW
HPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYIYSENGGNRNKK
GAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVRSSDTDKHYQTETIFK
DEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTNISGTIKNSASI
EYIGFLTSAGIKYIF
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaaattaaaattccttgtacttgcactttgtgtacctgcgatctttactacacatgct
accactaactatccacttttcataccggataacatcagtacggatattagtctaggatct
ctgagtggcaaaacaaaagaacgcgtttatcatcccaaggaaggggggagaaaaattagt
caactggactggaaatacagtaatgcgactattgttagaggtggcatcgattggaagcta
attccaaaagtgtctttcggagtttccggttggactactttaggtaaccagaaagcaagc
atggttgataaagactggaacaattccaatacccctcaggtatggaccgaccagagctgg
catcccaatacgcatctccgtgatgctaacgaattcgagctgaatcttaaaggttggtta
ttaaataatttggattatcgacttggactaatagcaggttaccaagagagtcgttacagt
tttaatgcaatgggagggagttatatttatagtgaaaacggggggaacaggaataaaaaa
ggggcacatcctagtggtgaaagaacaataggttacaaacagctcttcaaaataccttat
attggattaactgctaattaccgccatgagaattttgagtttggagcagaactgaaatat
agtggttgggttcgttcatctgatacagataaacactatcagactgagacgatttttaaa
gatgaaataaaaaaccaaaattactgctctgttgctgcgaatattggatactatgtcacc
cccagtgcaaaattttatatagaaggctccagaaattacatttctaataaaaaaggtgat
acatctctttatgagcaaagtaccaatatatctggcaccattaaaaatagtgcaagtatt
gaatatattggttttctcacttccgcaggtataaagtatattttttga

DBGET integrated database retrieval system