KEGG   Shewanella baltica OS223: Sbal223_2503Help
Entry
Sbal223_2503      CDS       T00803                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sbal223_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACK46997
UniProt: B8EAG8
LinkDB All DBs
Position
2978196..2978780
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEDIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTLAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacttatgttgttaagctaaac
ggcttaatcgaaggaactgatttcgctggtaaatctttagaagacatcatcaaaacttct
acgggtggcgtatttaacaacgcagctcaagtgtggaaccacactttctactggaactgc
ctagcaccaaacgctggcggcgagccaacaggcccagttgctgatgcaatcaatgctgct
ttcggttcatttgacgcatttaaagcacaatttactgattctgcagtaaacaacttcggt
agcgcttggacatggttagtgaaaaaagccgatggcacacttgctatcgtcaacactagc
aatgctgcaacgccactgactgacagctcagtcacgccaatcatgacagttgacgtgtgg
gaacacgcttactacatcgattaccgtaacgtgcgtcctgactaccttgcccacttctgg
caattagttaactgggacttcgttaaccaaaacttcgctggttaa

DBGET integrated database retrieval system