KEGG   Shewanella baltica OS223: Sbal223_2774Help
Entry
Sbal223_2774      CDS       T00803                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00250  Alanine, aspartate and glutamate metabolism
sbp00410  beta-Alanine metabolism
sbp00430  Taurine and hypotaurine metabolism
sbp00650  Butanoate metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp02024  Quorum sensing
Module
sbp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sbal223_2774
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal223_2774
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal223_2774
   00430 Taurine and hypotaurine metabolism
    Sbal223_2774
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal223_2774
Enzymes [BR:sbp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sbal223_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 LmjF365940-deam P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ACK47262
UniProt: B8E5H3
LinkDB All DBs
Position
3262283..3263932
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGSDNKVDVAKMRQAALELARKNIKVLAIVGVAGTTETGNVDPLAELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELVTEPELCLLTYRYVPARVQAAMKLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDNEFL
PALMAMVAQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccacagcatccgaagaaagtctgctccgcattttt
actgcaccggaagatgcaggatcaacgctgagtattatcgagcagaagctctccgaggac
ttagcaggctttttgggtgacagtatcgccgcgctcgaaaaacccttgtcggaaattgaa
accgattttcaagcctttgagatcccaactcagccgcgttttgtttccgattacaccgac
gaaattatgcaaaatctggtggcgcattcggtacacacagcggcaccaagttttatcggc
cacatgacgtcggcactgccctactttgtgttgccgctgtcgaaaatgatggtgggactg
aatcaaaatctggtcaaaatcgaaacctcaaaggcatttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatacggatttttatcaaagctggatg
cacagcgccaatcattccctcggcgcattttgctccggcggcacagtggccaacatcacg
gccctgtggattgcccgtaaccaattattgaaggccgatggcgagtttaaaggcgtcagc
cgcgaaggcttactcaaggcactgcgccactatggctatgacgatttagcgattttagtc
tcggagcgaggtcactattcgctgggcaaagccgtcgatctgcttggtatcggccgcgac
aatatcatcagcattcccacgggcagcgataacaaggtcgatgtcgcgaaaatgcgccaa
gccgcccttgaacttgcccgtaaaaacatcaaagtgttggcgattgttggcgtggcaggc
accacagaaaccggtaatgttgacccactggcagagttagcggcgctggcaaaagagtta
aactgccatttccatgtggatgcagcgtggggcggagcaagtttattatccaataaatac
cgccacttactcgctggtatcgaacttgccgattcagtcaccatcgatgcccacaaacaa
atgtacgtgcccatgggcgcaggtatggtgttatttaaagacccagagtttgcccacgcc
atcgcacatcacgccgaatacattctgcgccgtggttcaaaggacttaggcagccaaacg
ctggaaggttcgcgccccggcatggcgatgttagtacacgcttgcttgcaaatcatcggc
cgcgatgggtatgaaatcttaatcaataacagtcttgaaaaagcgcgttattttgcagag
caaatcaaagcccatgaggattttgagctggtcactgagccagaactgtgtctgctgact
taccgttatgtccccgcccgcgtacaagccgccatgaagctggcctgtgagcaagcagac
acgataagagtcgcccgctttaatgagctgctcgatggcctcactcagtttattcaaaag
caccaacgcgaacagggtaaatccttcgtctcccgcacccgcattcagccagcccgctat
tttaggcaagcaaccgtggtattccgtgtagtactcgctaaccccctcaccagccatgac
atcctcaatcaagtgctggtagaacaaagtgaaatcgctgcattagataacgagttttta
cccgcactcatggcgatggttgcccaatag

DBGET integrated database retrieval system