KEGG   Shewanella baltica OS223: Sbal223_3445Help
Entry
Sbal223_3445      CDS       T00803                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sbal223_3445
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sbal223_3445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_7 Thi4 Glutaredoxin FAD_binding_3 AlaDh_PNT_C NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACK47929
UniProt: B8E5S6
LinkDB All DBs
Position
4092728..4094314
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERT
PAMTVINPQLNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIVVDTRGQTSIPGVFAA
GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagcttagcg
caagacattgtcagcctatcttctctggtgagcctgaaagaaactcagggagaacgcacc
ccagcgatgacagtgataaacccacaacttaatacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcacttgtgttggccttactgcacacgggtggacacccaatc
aaactcagcgatgacattatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttacgtctcactgacctgccaaaactgcccagacgtagtgcaggcactgaacatgatg
gcggcgattaacccgaatatcaccaacgtgatgatcgacggcgccctgttccaagacgaa
gtggcgagccgtaacattatggccgtgccttctgtctacttaaatggcgaagtgtttgca
gccggtcgtatcagcattggcgagatcctcaataaactggataccaatgccgcaagccgc
aaagccgatgaaattaatgaaaaagcgccatttgaagtcttagtggtgggcggcggccca
gcgggcgcagcggcagctatttatgccgcacgtaaaggccttcgcactggtattgttgcc
gataagtttggcggccaagtggctgaaaccgttggtatcgagaactttatttcggtcaaa
gcgaccgaaggtcccaagctagtggcaaaccttgaagcccatgtacgagactacgaagtc
gacatcatggacaaccaaaaggcagtgtcgttatcaacagatggcttgttcgagcttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgttagccacaggtgcacgctgg
cgtgaaatgaacgtccccggcgagaaagaataccgtggcaaaggtgtcgcatactgtccg
cattgcgatggcccgttatttaaaggcaaacgtgtggcggtgattggcggcggtaactca
ggtatcgaagcagctatcgatcttgccaacatagtagaacatgtgactgtgctggagttt
gataaaaccctacgcgccgacgatgtgctgcaacgtaaagcggcgtctatgggtaacatt
aaaatcattacccaagccatgaccacagaagtgactggcgatggcactcgggttaatggc
ctgaactacacagacagagcaacaggcgagagtcaccatgtcgcacttgcaggtatcttc
gtgcaaattgggctagtaccgaataccgagtggctaaaaggtgtggttgaactgacgcca
cgtggggaaatcgttgtcgatacccgcggtcaaacatccatccctggagtatttgcggca
ggcgatgtcactgacacgccgtttaagcaaattatcatcgccatgggcagcggcgcgagt
gcatcactgggcgcatttgattacctaattcgccacagcgatgaagaaatcgccgaaacg
aaaaccacagacacgaaagcggcctaa

DBGET integrated database retrieval system