KEGG   Shewanella baltica OS223: Sbal223_3787Help
Entry
Sbal223_3787      CDS       T00803                                 

Definition
(GenBank) secretion protein HlyD family protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbp02000]
    Sbal223_3787
Transporters [BR:sbp02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Sbal223_3787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 HlyD_2 DUF4763 ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: ACK48264
UniProt: B8ECH9
LinkDB All DBs
Position
complement(4489835..4490893)
Genome map
AA seq 352 aa AA seqDB search
MSKSKLIIAVPLLLAAVAGGGYYWWTQVRFIETTDNAYVEADISHISVKVPGYVVLSDVT
DNQHVQKGELLAQLEDNQFSAKVSQAEASLASSKADLQTLAAKVELQRALITQASAGVVA
AESDKIRAQQQLSRSKKLKVSNYSSQDDVDQLQAGFDSAAARLDEAKAVLVAKQRELAVF
NAQLDQAGSVVEQADATLELAKIQLNDTRVTAPFSGVIGKRGAMVGQYVQPGQALYSLVP
DGAVWITANFKETQIQHMQPGQSVQVSLDAFPDKTFIGVIDSLSPASGAKFSLLPAENAT
GNFTKIVQRIPVRIRLDLSEEEAHMLPGLSAVVKVDTASGTAISAIAANTGR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagtaaactcattatcgccgttccactgttactcgctgcggttgcgggaggc
ggttattactggtggacacaggtacgttttatcgaaaccactgataacgcttatgttgag
gccgatatttcccatatcagcgttaaagtgcccggctacgtcgtgttaagcgatgtgacc
gataaccagcatgtgcaaaagggagagttattagctcagctcgaagataaccaatttagc
gccaaagtgagtcaagccgaagcctcactggcaagttcgaaggcggacttgcaaacctta
gccgctaaggtggagttacaacgggcgttaatcacccaagccagtgccggtgttgtggcg
gctgagtcagataaaatacgtgcacagcaacaattgagccgctcgaaaaagcttaaagtc
agtaattacagctctcaagatgatgtcgatcaactgcaagcgggattcgattctgccgcc
gcacgtctcgatgaagccaaagccgtgttagtggcaaagcaacgcgagttagcggttttt
aatgcccaattagatcaggcgggttctgtggtagaacaggccgatgcgaccttagaattg
gcgaaaattcaattaaatgatacccgtgtgaccgcacctttttctggggtgattggtaaa
cgtggcgctatggtggggcagtacgtgcaacccggccaagcactctacagtttggttccg
gatggggcagtgtggatcacggcgaactttaaagagacccagatccaacacatgcaacca
ggacagtcggtgcaggtcagtctcgatgcgtttcccgacaaaacctttataggtgttatc
gatagtctgtcaccggcgtccggagccaaatttagtctattgcctgcggaaaatgctaca
ggtaacttcactaaaatcgtccaacgtattcccgtgcgtattcgcttagatttgtctgag
gaagaagcacacatgctaccgggcttaagtgcggttgtgaaagtggatacggcgtcgggt
actgcaatatcggcaatcgctgcaaatacaggtcgttag

DBGET integrated database retrieval system