KEGG   Shewanella baltica OS223: Sbal223_4286Help
Entry
Sbal223_4286      CDS       T00803                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00260  Glycine, serine and threonine metabolism
sbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal223_4286
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Sbal223_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 TrkA_N Methyltransf_25 FAD_oxidored UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACK48752
UniProt: B8EDS6
LinkDB All DBs
Position
5092718..5093743
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEKGIWLVDAPKPVMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTIPVPMV
VGHEYVGEVVDIGQEVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGS
FAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELGMTEGFDVGLEMS
GVPSAFHAMLDTMNHGGKVAMLGIPGGEMAIDWSKVIFKGLVIKGIYGREMFETWYKMAS
LIQSGLDISPIITHHFKIDDFQQGFDAMGSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactaagcaagttaaaagccgaaaaaggtatttggttagtcgatgcgcctaag
ccagtaatgggccacaacgatctgctgatcaaaattaaaaaaacggcgatttgtggcacc
gacatgcacatctacaactgggacgagtggtcacaaaaaaccattcccgttcctatggtt
gttggccatgaatatgtaggcgaagtggttgatatcggacaagaagtgcgtggttttaag
attggcgaccgcgtatctggcgaaggtcatattacctgcggccactgccgtaactgtcgc
gctggccgcacccatttatgccgcaacacctctggtgtcggtgtaaaccgtgaaggttca
ttcgcggaatacttagtgattcccgcctttaacgcctttaaaatccctgatgacatcagc
gatgatttagcgtcaatcttcgacccgtttggtaacgctgtgcacacagcattatccttc
gatttagtcggtgaagacgtcttgatcacaggcgcaggcccaatcggcataatggctgcg
gcagtatgtcgtcacgtaggtgcgcgccatgtagtaatcaccgacgttaacgaataccgc
ttagagctggcccgtaaaatgggtgcgactcgcgcagtgaacgtgtctaaagaaagcctg
aaagacgtgatgaaggaactgggcatgaccgaaggtttcgacgtcggcttagaaatgtct
ggcgtaccatcagccttccacgccatgttagataccatgaaccacggcggcaaagtcgct
atgctgggtattcctggtggcgaaatggcgattgattggagcaaagtgatcttcaaaggt
ttggtcattaaaggcatctacggccgtgaaatgttcgaaacttggtacaagatggcgagc
cttatccaatctggcttagatatttcgcctatcatcactcaccacttcaagattgatgat
ttccaacaaggtttcgacgccatgggctcgggccaatcgggtaaagtgatcctcagctgg
gattaa

DBGET integrated database retrieval system