KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027381
Entry
101027381         CDS       T04350                                 

Gene name
NR1H3
Definition
(RefSeq) oxysterols receptor LXR-alpha isoform X1
  KO
K08536  liver X receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101027381 (NR1H3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101027381 (NR1H3)
   04931 Insulin resistance
    101027381 (NR1H3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101027381 (NR1H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101027381 (NR1H3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101027381 (NR1H3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101027381 (NR1H3)
Nuclear receptors [BR:sbq03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   101027381 (NR1H3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101027381
NCBI-ProteinID: XP_003920109
UniProt: A0A2K6TTE6
LinkDB
Position
Unknown
AA seq 447 aa
MSLWLGAPVPDIPPDSAVALWKPGTQDASSQAQGGSSCTLREEARIPYSAGGTAGVGLEA
AEPTALLTRAEPPSEHPELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHGGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPLRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccttgtggctgggggcccctgtgcctgacattcctcctgactctgcagtggcgctg
tggaagccaggcacacaggatgcaagcagccaggcccagggaggcagcagctgcaccctc
agagaggaagccaggataccctactctgccgggggcactgcaggggtggggctggaggct
gctgagcccacagccctgctcaccagggcagagcccccttcagaacacccagagctccgt
ccacaaaagcggaaaaaggggccagcccccaaaatgctggggaacgagttatgcagcgtg
tgtggggacaaggcctccggtttccactacaacgttctgagctgcgagggctgcaaggga
ttcttccgccgcagcgtcatcaagggagcgcgctatgtctgccacggcggcggccactgc
cccatggacacctatatgcgtcgcaagtgccaggagtgtcggcttcgcaaatgccgccag
gctggcatgcgggaggagtgcgtcctgtcagaagaacagatccgcctgaagaaactgaag
cggcaagaggaggaacaggctcatgctacatccctgcccctcagggcttcctcacccccc
cagatcctgccccagctcagcccagagcaactgggcatgatcgagaagctggttgctgcc
cagcaacagtgtaaccggcgctccttttctgaccagcttcgagtcacgccttggcccatg
gcaccagacccccacagccgggaggcccgtcagcagcgctttgcccacttcactgagctg
gccatcgtctctgtgcaggagatagttgactttgctaaacagcttcctggcttcctgcag
ctcagccgggaggaccagattgccctgctaaagacctctgcgatcgaggtgatgcttctg
gagacatcgcggaggtacaaccctgggagtgagagtatcaccttcctcaaagatttcagt
tataaccgggaagactttgctaaagcagggttgcaggtggaattcatcaaccccatcttc
gagttctccagggccatgaatgagctgcaactcaatgatgccgagtttgctttgctcatt
gccatcagcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagagg
ctgcagcacacgtatgtggaagccctgcatgcatacgtctccatccaccatccccacgac
cgactgatgttcccacgaatgctgatgaaactggtgagcctccggaccctgagcagcgtc
cactcagagcaagtgtttgcactgcgcctgcaggacaagaagctcccaccgctgctctct
gagatctgggatgtgcacgaatga

DBGET integrated database retrieval system