KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027444
Entry
101027444         CDS       T04350                                 

Gene name
PKM
Definition
(RefSeq) pyruvate kinase PKM isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00230  Purine metabolism
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq01230  Biosynthesis of amino acids
sbq01240  Biosynthesis of cofactors
sbq04922  Glucagon signaling pathway
sbq04930  Type II diabetes mellitus
sbq05165  Human papillomavirus infection
sbq05203  Viral carcinogenesis
sbq05230  Central carbon metabolism in cancer
Module
sbq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbq_M00002  Glycolysis, core module involving three-carbon compounds
sbq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sbq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101027444 (PKM)
   00620 Pyruvate metabolism
    101027444 (PKM)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101027444 (PKM)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101027444 (PKM)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101027444 (PKM)
   05230 Central carbon metabolism in cancer
    101027444 (PKM)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101027444 (PKM)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101027444 (PKM)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     101027444 (PKM)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101027444 (PKM)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101027444 (PKM)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 101027444
NCBI-ProteinID: XP_003929715
UniProt: A0A2K6TTW3
LinkDB
Position
Unknown
AA seq 531 aa
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcgaagccccatagtgaagccgggactgccttcattcagacccagcagctgcatgca
gccatggccgacacattcctggagcacatgtgccgcctggacattgactcaccacccatc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcggtggagaca
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcacggaact
catgagtaccacgcggagaccatcaagaatgtgcgcgcagccacggagagctttgcttct
gaccccatcctctaccggcccgttgctgtggctctggacactaaaggacctgagatccga
actggcctcatcaagggcagcggcactgcagaggtggagctgaagaagggagccactctc
aaaatcacgctggacaacgcctacatggagaagtgtgacgagaacatcctgtggctggac
tacaagaatatctgcaaggtggtggaagtgggcagcaagatctatgtggatgatgggctt
atttctctccaggtgaagcagaaaggtgctgacttcctggtgacagaggtggaaaatggt
ggctccttgggcagcaagaaaggtgtgaaccttcctggggctgctgtggacttgcctgct
gtgtcagagaaggacatccaggacctgaagtttggggttgagcaggatgtcgatatggtg
tttgcgtcattcatccgcaaggcagctgatgtccatgaagtgaggaaggtcctgggagag
aagggaaagaacatcaagatcatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatctaggcattgaa
attcctgcagagaaggtcttccttgctcagaagatgatgattgggcggtgcaaccgagct
gggaagcctgtcatctgtgccactcagatgctggagagcatgatcaagaagccccgccct
acccgggctgagggcagtgatgtggccaatgcagtcctggatggagctgactgtatcatg
ctgtctggagagacagccaaaggggactatcctctggaggccgttcgcatgcagcacctg
attgcccgtgaggcagaggccgccatctaccacttgcaattatttgaggaactccgccgc
ctggcccccattaccagcgaccccacagaagccaccgccgtgggtgccgtggaggcttcc
ttcaagtgctgcagtggggccataatcgtcctcaccaagtctggcaggtctgctcaccag
gtggccagataccgcccacgtgcccccatcattgctgtgacacggaatccccagacagct
cgtcaggctcacctgtaccgtggcatcttccctgtgctgtgcaaggaccccgtccaggag
gcctgggctgaggacgtggatctccgggtgaacttggccatgaatgtcggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccgggtggcgccctggctccggc
ttcaccaacaccatgcgcgttgttcctgtgccgtga

DBGET integrated database retrieval system