KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027540
Entry
101027540         CDS       T04350                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101027540 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101027540 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 101027540
NCBI-ProteinID: XP_010329702
UniProt: A0A2K6S8P5
LinkDB
Position
Unknown
AA seq 400 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTSIPENDTVDGREEKPASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGIAPSQPGAYQPR
PGFTSLPGSAVAAPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaacggacagttggatctgagtgggaagctcatcatcaaagctcaacttggggaggat
attcggcgaattcctattcataatgaagatattacttacgatgagttggtgctaatgatg
caacgagtgttcagaggaaaacttctgagtaatgatgaagtaacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgt
agtaggatactgaaactgacattatttgttaatggccaaccaagaccccttgaatcaagt
caggtgaaatacctccgtcgagaactgatagaacttcgaaataaagtgaatcgtttattg
gatagcttggaaccaccgggagaaccagggccttccaccagtattcctgaaaatgatact
gtggatggtagggaagaaaagcctgcttctgattcttctggaaaacagtctactcaggtt
atggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaaaat
gttatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcctgca
gaagatcgttcaggaacacccgacagcattgcttcctcctcctcagcagctcacccacca
ggagttcagccacagcaaccaccatatacaggagctcagacacaagcaggtcagattgaa
ggtcagatgtaccaacagtaccagcaacaggccggttatggcgcgcagcaaccgcaggct
ccgcctcagcagcctcaacagtatggtattcagtattcagcaagctatagtcagcagact
ggaccccaacaacctcagcaattccagggatatggccagcaaccaacttcccaggcacca
gctcctgccttttctggtcagcctcaacaactgcctgcccagccgccacagcagtaccag
gcgagcaattaccctgcacaaacttacactgcccaaacttctcagcctactaattataca
gtagctcctgcctctcagcctggaatagctccaagccaacctggggcctatcagccaaga
ccaggttttacttcacttcctggaagtgccgtggccgcccctccaagcgggcctaatcct
tacgcacgtaaccgccctccctttggccagggctatacccagcctgggcctggctatcgg
taa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035626
Entry
101035626         CDS       T04350                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor isoform X2
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04722  Neurotrophin signaling pathway
sbq04750  Inflammatory mediator regulation of TRP channels
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035626 (NTRK1)
   04014 Ras signaling pathway
    101035626 (NTRK1)
   04020 Calcium signaling pathway
    101035626 (NTRK1)
   04151 PI3K-Akt signaling pathway
    101035626 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101035626 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101035626 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101035626 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035626 (NTRK1)
   05202 Transcriptional misregulation in cancer
    101035626 (NTRK1)
   05230 Central carbon metabolism in cancer
    101035626 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101035626 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101035626 (NTRK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101035626 (NTRK1)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   101035626 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 I-set LRR_8 TrkA_TMD Ig_3 Ig_2
Other DBs
NCBI-GeneID: 101035626
NCBI-ProteinID: XP_003937905
UniProt: A0A2K6TDM7
LinkDB
Position
Unknown
AA seq 796 aa
MLRGGRRGQLGWHCWAAGPSSLLAWLMLASAGAAPCPDACCPHGPSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVRGLPLQELVLSGNPLHCSCALRWLQRWEEEGLGGVREQKLQCHGL
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVPLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLELTLANVTRDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVELQDAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPLGQAAASIMAAFMDNPFEFNPEDPIPVSFSPADTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagctcggctggcactgctgggctgcggggccgagc
agcctgctggcttggctgatgttggcatctgcaggcgccgcaccctgccccgatgcctgc
tgcccccacggtccctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcctggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgacctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaaccgtgcggggcctcccctta
caggaactggtcctgtccgggaaccctctgcactgttcctgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcgcgaacagaagctgcaatgtcatgggctg
gggcccctggcccatatgcccaatgccagctgtggtgtgcccacgttgaaggtccaggtg
cccaacgcctccgtggatgtgggggacgacgtgccactgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacggagctggagcagtcagccacagtgatgaaa
tctgggggtctgccatccctggagctgaccctggccaatgtcacccgtgacctcaacagg
aagaatgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagcgtggagctgcaggacgcggtggagatgcaccactggtgc
atccccttctcggtggatgggcagccggcaccgtctctgcgctggctcttcaacggctcg
gtgctcaacgagaccagcttcatcttcaccgagttcctggagccggcggccaatgagacc
gtgcggcacggctgcctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggccgccaaccccctgggccaggccgccgcctccatcatggccgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccagcggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gccgtgggcctggctgtctttgcctgcctcttcctttccacgctgctccttgtgctcaac
aaatgcggacggagaaacaagtttggaatcaaccgcccggctgtgctggctccagaggac
gggctggccatgtccctgcatttcatgacattgggtggcagttccctgtcccccactgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcatcacatcaagcgccgggacatcgtgctcaagtgggagctgggcgagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggccgtcaaggcactgaaggaggtgtcggagagcgcccggcaggacttccagcgcgag
gccgagctgctcaccatgctgcagcaccagcacattgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcatggggacctcaaccgcttc
ctccgatcccatgggcctgatgccaagctgctggctggcggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagtcaggtggctgcggggatggtgtac
ctggcgggtctgcacttcgtacaccgggacctggccacgcgcaattgtctggtgggccag
ggactggtggtcaagattggcgatttcggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccatccgctggatgccgcccgagagcatcctg
taccgcaagttcaccaccgagagcgacgtgtggagctttggcgtggtgctctgggagatc
ttcacctatggcaagcagccctggtaccagctctccaacaccgaggcgatcgaatgcatc
acgcagggacgtgagttggagcggccacgggcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgc
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038731
Entry
101038731         CDS       T04350                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101038731 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    101038731 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038731 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101038731 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101038731 (TPM3)
   05414 Dilated cardiomyopathy
    101038731 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101038731 (TPM3)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     101038731 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM DUF745 Crescentin CENP-F_leu_zip XhlA DUF3450 ATG16 HrpB7 DHR10 DUF1664 SlyX Golgin_A5 Laminin_I AAA_13 DUF16 MAD
Other DBs
NCBI-GeneID: 101038731
NCBI-ProteinID: XP_003941907
UniProt: A0A2K6T1Q4
LinkDB
Position
Unknown
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttggacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattctgaagctctgaaggatgcccaggagaagctggagctggcagagaagaaggctgct
gatgccgaggctgaggtggcctccttgaaccgtaggatccagctggttgaagaggagctg
gaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagctgaaaaagct
gctgatgagagcgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagag
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaaatatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagac
aaatatgaggaagagatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaat
gacatgacctctatataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040194
Entry
101040194         CDS       T04350                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101040194
   04261 Adrenergic signaling in cardiomyocytes
    101040194
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040194
  09162 Cancer: specific types
   05216 Thyroid cancer
    101040194
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101040194
   05414 Dilated cardiomyopathy
    101040194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101040194
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     101040194
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip Crescentin CLZ DUF1664 DUF745 BORCS7 MAD DUF16 NPV_P10 Exonuc_VII_L ADIP
Other DBs
NCBI-GeneID: 101040194
NCBI-ProteinID: XP_003939560
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKCKIQVLQQQVDDAEERAECLQREVEGERRALEQAEAEVASLNRRIQLVE
EELDRAQERLATSLQRLEEAEKAADERERVMKVIENRALKDEEKVELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELTESRCQEMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggttaagtgcaagatccaggtgctgcagcaacag
gtggatgatgcagaggagcgagctgagtgcctccagcgagaagttgagggagaaaggcgg
gccctggaacaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcgcctggccacttccctgcaaagactggaagaagct
gaaaaagctgctgatgagcgtgagagagttatgaaggttattgaaaatcgggccttaaaa
gatgaagagaaggtggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttg
gaacgcacagaagaacgagctgagctgacagagtcccgttgccaagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaacttaaggaggcagag
actcgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052248
Entry
101052248         CDS       T04350                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101052248
   04261 Adrenergic signaling in cardiomyocytes
    101052248
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052248
  09162 Cancer: specific types
   05216 Thyroid cancer
    101052248
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101052248
   05414 Dilated cardiomyopathy
    101052248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101052248
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     101052248
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip WES_acyltransf DUF745 EzrA DUF1664 Fib_alpha Lebercilin MAD ERM
Other DBs
NCBI-GeneID: 101052248
NCBI-ProteinID: XP_003930410
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVDRKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETHAEFAERSVAKLEKTIDDLEDKLICTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgacgcagaggagcgagctgagcgcctccagcgagaagttgagggagaaaggcgg
gcccgggaacaggccgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagct
gaaaaagctgctgatgagagcgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagagaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaaatatgaagaggtggatcgtaagttggtgatcattgaaggagacttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccatgctgagtttgcagagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgatatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052619
Entry
101052619         CDS       T04350                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101052619
   04261 Adrenergic signaling in cardiomyocytes
    101052619
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052619
  09162 Cancer: specific types
   05216 Thyroid cancer
    101052619
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101052619
   05414 Dilated cardiomyopathy
    101052619
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101052619
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     101052619
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip WES_acyltransf Laminin_I DUF745 DUF1664 Lebercilin Crescentin Fib_alpha CLZ MAD
Other DBs
NCBI-GeneID: 101052619
NCBI-ProteinID: XP_010331584
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVDRKLVIIEGDLERTEERAELTESRCQEMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgacgcagaggagcgagctgagcgcctccagcgagaagttgagggagaaaggcgg
gcccgggaacaggccgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagct
gaaaaagctgctgatgagagcgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagagaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaaatatgaagaggtggatcgtaagttggtgatcattgaaggagacttg
gaacgcacagaagaacgagctgagctgacagagtcccgttgccaagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgcagagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053929
Entry
101053929         CDS       T04350                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR
  KO
K09291  nucleoprotein TPR
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03013  RNA transport
sbq05014  Amyotrophic lateral sclerosis
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101053929 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053929 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101053929 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101053929 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101053929 (TPR)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101053929 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 DUF1192 Imm70
Other DBs
NCBI-GeneID: 101053929
NCBI-ProteinID: XP_003925329
LinkDB
Position
Unknown
AA seq 2439 aa
MPSSGSVSRSRPRGRPMASRGFDGSRRGSLRRAGAREPPSEVIEAAAQASGSSWCPPFFS
ASTPSAAAPGARGPTDMAAVLQQVLERTELSKLPKSVQNKLEKFLADQQSEIDGLKGRHE
KFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNSQLKTVTEKNKELEIAQD
RNIAIQSQFTRAKEELEAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQL
KLDELQASDVSVKYREKRLEQEKELLHNQNTWLNTELKTKTDELLALGREKGNEILELKC
SLENKKEEVSRLEEQMNDLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIK
LSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKAIQDHLLEVEESKDQMEKEMLE
KIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVE
TQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKE
IQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSA
DISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKISELQLKLE
SALTELEQLRKSRQHQMHLVDSIVRQRDMYRILLSQTTGVAIPLQASGLDDISLASTPKR
PSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQV
TDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMT
QDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQSLLLTNLQTIQG
ILERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDAET
NLHVNTKELLKNAQKEIATLKQHLSNMEVQLASQSSQRTGKGQPNNKEDVDDLVSQLRQA
EEQVNDLKERLKTSTSNVEQYRAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQL
EKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQA
RRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQL
LECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGMQGPLNV
SLSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNA
EREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQTQAKVRKLELDI
LPLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVH
TKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLTKVRTEKENIQKDLDAKIIDI
QEKVKTITQVKKIGRRYKTQYEELKAQQDKVLETSAQSSGDHQEQHVSVQEMQELKETLN
QAETKSKSLESQVENLQKTLSEKETETRNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQ
QITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKS
QYEGRISRLERELREHQERHLEQRDEPQEPTNKVPEQQRQISLKTTPASGERGIASISDP
PTANIKPTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVE
SQEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHP
QIEPANQELSPSIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASD
QVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYT
PMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHED
YEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGG
GESNQRAADSQNSGEGNTGAAESSFTQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPR
LTIHAPPQELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPH
RTDGFAEAIHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEE
ESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETAAGDDGD
EVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFR
RVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 7320 nt   +upstreamnt  +downstreamnt
atgccctctagtggctcagtgtccagaagccgcccaagaggacgacccatggcatcccgg
ggctttgacgggtcccgccgcgggagtctccggcgggctggcgcgcgcgagccgccgagc
gaggtgatagaggcggcggcgcaggcttctgggtcctcctggtgtccgcctttcttctcc
gcctctaccccgtcagccgctgcccctggggctcgtggccccaccgacatggcggcggtg
ttgcagcaagtcctggagcgcaccgagctgagcaagctgcccaagtccgtccagaacaaa
cttgaaaagttcctcgctgatcagcagtccgagatcgatggcctgaaggggcggcacgag
aaattcaaggtggagagcgaacaacagtattttgaaatagaaaagagactgtcccacagt
caagagagacttgtgaatgaaacccgagagtgtcagagcttgcggcttgagctagagaaa
ctcaacagtcaactgaagacagtaactgagaaaaacaaagaacttgaaattgctcaggat
cgcaatatcgctattcagagtcaatttacaagagcaaaggaagaattagaagctgagaaa
agagacttaattagaaccaatgagagactatctcaagaacttgaatacttaacagaggac
gttaaacgtctaaacgaaaaacttaaagaaagcaatacaacgaagggtgaacttcagtta
aaattggatgaacttcaagcttctgatgtttctgttaagtatcgagaaaaacgcttggaa
caagaaaaggaattgctacataatcagaatacatggctgaatacagagttgaaaaccaaa
actgatgaacttttggctcttggaagagaaaaaggaaatgagattctagagcttaaatgt
agtcttgaaaataaaaaagaagaggtttctagactggaagaacagatgaatgacttaaaa
acatcaaatgaacatcttcaaaagcatgtagaggatctgttgaccaaattaaaagaggcc
aaggagcaacaggccagtatggaagagaaattccataacgaattaaatgcacacataaaa
ctttctaacttgtacaagagtgccgctgatgactcagaagcaaagagcaatgaactaacc
cgggcagtggatgaactacacaaacttttgaaagaagctggtgaagccaataaagcaata
caagatcatcttctagaggtggaggaatctaaagatcaaatggaaaaagaaatgctagag
aaaatagggaaattggagaaggaattagagaatgccaatgaccttctttctgccacaaaa
cgtaaaggagccatattatctgaagaagagcttgcagccatgtctcctactgcagcagct
gtagctaagatagtgaaacctgggatgaaattaacagagctctataatgcttatgtggaa
actcaggatcagttgcttttggagaaactggagaacaaaagaattaataagtacctagat
gaaatagtgaaagaagtggaagccaaagcaccaattttgaaacgccagcgtgaagaatat
gaacgagcacagaaagctgtagcaagtttatctgttaagcttgaacaagctatgaaggag
attcagcgattgcaggaggacactgataaagccaacaaacattcatctgtacttgagaga
gacaatcaaagaatggaaatacaaataaaagatctttcacaacagattagagtgcttctg
atggaacttgaagaagcaaggggtaaccatgtaattcgtgacgaggaagtaagctctgct
gatataagtagttcatcggaggtaatatcacagcatttagtatcttatagaaatattgaa
gagcttcaacaacaaaatcaacgtcttttggtggcccttagagagcttggggaaaccaga
gaaagagaagaacaagaaacaacttcatccaaaatcagtgagcttcagcttaaacttgag
agcgccctcaccgaactagaacaactccgcaaatcacgacagcatcagatgcaccttgtt
gattccatagttcgtcagcgtgatatgtaccgtattttattgtcgcaaacaacaggagtt
gccattccattgcaagcttcaggcttagatgatatttctcttgcatcaactccaaaacgt
ccaagtacatcacagactgtttccactcctgctccagtacctgttattgaatcaacagag
gccatagaggctaaggctgccctgaaacagttgcaggaaatttttgagaactacaaaaaa
gaaaaagcagaaaatgaaaaaattcaaaatgagcagcttgagaaacttcaagagcaagtt
acagatttgcgatcacaaaataccaaaatttctacccagctagactttgcttctaaacgt
tatgaaatgttgcaagataatgttgaaggatatcgtcgagaaataacatctcttcatgag
agaaatcagaagctcactgcaaccactcaaaagcaagaacagattatcaatacaatgact
caggatttgagaggagcaaatgagaagctagctgtcgcagaagtaagagcagaaaatttg
aagaaggaaaaagaaatgcttaaattgtccgaagttcgtctttcccagcagagagagtct
ttgttagctgaacaaaggggacaaagtttgctgctgactaatctgcaaacaattcaggga
atactggagcgatctgaaacagaaaccaagcaaaggcttagtagccagatagaaaaattg
gaacatgagatctctcatctaaagaagaagttggaaaatgaggtggaacaaaggcataca
cttacaagaaatctggatgttcagcttttagatacaaagagacaactggatgcagagaca
aatcttcatgttaacacaaaagaactattaaaaaatgctcaaaaggaaattgctacattg
aaacagcacctcagtaatatggaagtccagcttgcttctcagtcttcacagagaactggt
aaaggtcagcctaacaacaaagaagatgtggatgatcttgtgagtcaactgagacaggca
gaagagcaggtgaatgacttaaaagagagactcaaaacaagtactagcaatgtggaacaa
tatcgagcaatggttactagtttagaagaatcgctgaacaaggaaaaacaggtaacagaa
gaagtacgtaagaatattgaagttcgtttgaaagagtcagctgagtttcagacacagttg
gaaaagaagttgatggaagtagagaaggagaaacaagaacttcaggatgataagagaaga
gccatagagagcatggaacaacagttatctgaattgaagaaaacactttctagtgttcag
aatgaagtacaagaagcccttcagagagcaagcacagctttgagtaatgagcagcaagcc
agacgtgactgtcaggaacaagctaaaatagctgtggaagctcagaataagtatgagaga
gaattgatgctgcatgctgctgatgttgaagctctacaagctgcgaaggaacaagtttca
aaaatggcctcagtccgtcagcatttggaagaaacaacccagaaagcagaatcacagtta
ctggagtgcaaagcatcttgggaggaaagagagagaatgttaaaggatgaggtttccaaa
tgtgtatgtcgctgtgaagatctggagaaacaaaacagattacttcatgatcagattgaa
aaattaagtgacaaggtcgttgcctctgtgaaggaaggtatgcaaggtccactgaatgta
tctctcagtgaagaaggaaaatctcaagaacaaattttggaaattctcagattcatacgg
cgagaaaaagaaattgctgaaactaggtttgaggtagctcaggttgagagtctgcgttat
cgacaaagggttgaacttctagaacgagagctgcaggaactgcaagacagtctaaatgct
gaaagggaaaaagtccaggtaactgcaaaaacaatggctcagcatgaagaactgatgaag
aaaactgaaacaatgaacgtagttatggagaccaataaaatgctgagagaagaaaaggag
agattagaacaggatctacagcaaacgcaagcaaaggtgaggaaactggagttagatatt
ttacccttacaagaagcgaatgctgagctgagtgagaaaagtggtatgctacaggcagag
aagaagctgttagaagaggatgtcaaacgttggaaagcacgtaaccagcatctagtcagt
caacagaaagatccagatacagaagaatatcggaagctcctttctgaaaaggaagttcat
actaagcgtattcaacagttgacagaagaaattgggagacttaaagctgagattgcaaga
tcaaatgcatctttgactaacaaccagaacttaattcagagcctgaaggaagatctgact
aaagtaagaactgaaaaagaaaacatccagaaggacttagatgccaaaataattgatatc
caagaaaaagtcaaaactattactcaagtaaagaaaattggacgtaggtacaagactcag
tatgaagaacttaaagcacaacaggataaggttttggagacatcagctcaatcctctgga
gaccatcaggaacagcatgtttcagtccaggagatgcaggaactcaaagaaacgctcaac
caagctgaaacaaaatcaaaatcactcgagagtcaagtagagaatctgcagaagacatta
tctgaaaaagagacagaaacaagaaatcttcaggaacagactgtgcaacttcagtctgaa
ctttcacgacttcgtcaggatcttcaggatagaaccacacaggaggagcagctccgacaa
cagataactgaaaaggaagaaaaaacaagaaaggctattgtagcagccaaatcaaaaatt
gcacacttagctggtgtaaaagatcagctaacgaaagaaaatgaggagcttaaacaaagg
aatggagccttagatcagcagaaagatgaactggatgttcgtattactgctctcaagtcc
caatatgaaggtcgaattagtcgcttggaaagagaactcagggagcatcaagagagacac
cttgagcaaagagatgagcctcaagaacctactaataaggtccctgaacagcagagacag
atctcactgaaaacaactccagcttccggtgaaagaggaattgccagcatatcagatcca
ccaacagccaatataaagccaactcctgttgtgtctactccaagtaaagtgacagctgca
gctatggctggaaataagtcaacacccagggcgagtatccgcccaatggttacacctgca
actgttacaaatcccactactaccccaacagctacagtgatgcccactacacaagtggaa
tcacaggaagctatgcagtcagaaggccctgtggaacatgttccagtttttggaagcaca
agtggatctgttcgttctactagtcctaatgtccagccttctatctctcaacctatttta
actgttcagcagcaaacacaggctacagcatttgtgcaacccactcaacagagtcatcct
cagattgagcctgccaatcaagagttatctccaagcatagtagaggttgttcagagttca
ccagttgagcggccttctacttccacagcagtatttggcacagtttcggctaccccaagt
tcttctctgccaaagcgtacacgtgaagaggaggaggatagcaccatagaagcatcagac
caagtctctgatgatacagtggaaatgcctcttccaaagaagttgaaaagtgttacacct
gtaggaactgaggaagaagttatggcagaagaaagtactgatggagaagtagagactcaa
gtatacaatcaggattctcaagattccattggagaaggtgttacccagggagattataca
cctatggaagacagtgaagaaacctcgcagtctctacaaatagatcttggaccacttcaa
tcagatcagcaaacaacaacttcatcccaggatggtcaaggcaaaggagatgatgtcatt
gtaattgacagtgatgatgaagaagaggatgatgatgaaaatgatggagaacatgaggac
tatgaagaggatgaggaagatgatgatgatgatgaagatgacacagggatgggagatgag
ggtgaagatagtaatgaaggaactggtagtgccgatggcaatgatggttatgaagctgat
gacgctgagggtggtgatgggactgatccaggtacagaaacagaagaaagtatgggtgga
ggtgaaagtaatcagagagctgctgattctcaaaacagtggtgaaggaaatacaggtgct
gcagaatcttcttttactcaggaggtttctagagaacaacagccatcctcagcgtctgaa
agacaggcgcctcgagcacctcagtcaccaaggcgcccaccacatccgcttcccccaaga
ctgaccattcatgctccacctcaggagttgggaccaccagttcagagaattcagatgacc
cgaaggcagtctgtaggacgtgggcttcagctgactccaggaataggtggtatgcaacag
catttttttgacgatgaagacagaacagttccaagtactccaactcttgtggtgccacat
cgtactgacggatttgctgaagcaattcattccccacaggttgctggtgtccctagattc
cggtttgggccacctgaagatatgccacaaacaagttctagtcactctgatcttggccag
cttgcttctcaaggaggtttaggaatgtacgaaacaccactgttcctagctcatgaagaa
gagtcaggtggccgaagcgttcccactactccactgcaagtagcagccccagtgactgtc
tttactgagagtaccacctccgatgcttcggaacatgcctctcagtctgttccaatggtg
actacatccactggcactttatctacaacaaatgaaacagcagcaggtgatgatggagat
gaagtatttgtggaggcagaatctgaaggtattagttcagaagcaggcctagaaattgat
agccaacaggaagaagagccggttcaagcatctgatgagtcagatctcccctcgaccagc
caggatcctccttccagctcctctgtagatactagcagtagtcaaccaaagcctttcaga
cgagtaagacttcagacaacattgagacaaggtgtccgtggtcgtcagtttaacagacag
agaggtgtgagtcatgcaatgggagggagaggaggaataaatagaggaaatattaattaa

DBGET integrated database retrieval system