KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027603Help
Entry
101027603         CDS       T04350                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00590  Arachidonic acid metabolism
sbq01100  Metabolic pathways
sbq04064  NF-kappa B signaling pathway
sbq04370  VEGF signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04726  Serotonergic synapse
sbq04913  Ovarian steroidogenesis
sbq04921  Oxytocin signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq05140  Leishmaniasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05204  Chemical carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101027603 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101027603 (PTGS2)
   04064 NF-kappa B signaling pathway
    101027603 (PTGS2)
   04668 TNF signaling pathway
    101027603 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101027603 (PTGS2)
   04657 IL-17 signaling pathway
    101027603 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101027603 (PTGS2)
   04913 Ovarian steroidogenesis
    101027603 (PTGS2)
   04921 Oxytocin signaling pathway
    101027603 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    101027603 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    101027603 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101027603 (PTGS2)
   05206 MicroRNAs in cancer
    101027603 (PTGS2)
   05204 Chemical carcinogenesis
    101027603 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    101027603 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    101027603 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101027603 (PTGS2)
   05165 Human papillomavirus infection
    101027603 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    101027603 (PTGS2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101027603 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101027603
NCBI-ProteinID: XP_010347061
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
LLCAALALGRAANPCCSYPCQNQGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLF
LKPTPNTVHYILTHFKGFWNFVNNIPFLRNAIMSYVLTSRAHLIESPPTYNVDYGYKSWE
AFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSSEIVEKFLLRRKFIPDPQGSNMMFAF
FAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKYQIIDGE
MYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEH
PEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAE
FNTLYHWHPLLPDTFQIHDQNYNYQQFIYNNSMLLEHGVTQFVESFTKQIAGRVAGGRNV
PPAVKKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMAAELKALYGDIDA
MELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFKIIN
TASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKERSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
ctgctgtgcgccgccctggcgctcggccgtgcagcaaatccgtgctgttcctacccatgt
caaaaccaaggtgtatgtatgagtgtgggatttgaccagtacaagtgtgattgtacccgg
acaggattctatggtgaaaactgctcaacaccggaatttctgacaagaataaaattgttt
ctgaaacccactccaaacacagtgcactacatacttacccacttcaagggattttggaac
tttgtcaataacattcccttccttcgaaatgcgattatgagttacgtgttgacatccaga
gcacatttgattgagagtccgccaacctacaatgttgactatggctacaaaagctgggaa
gccttctctaacctctcctattatactagagcccttcctccagtacctgatgactgcccc
actcccctgggtgtgaaaggtaagaagcagcttcctgattcaagtgagattgtggaaaaa
tttcttctaagaagaaagttcatccctgatccccagggctccaatatgatgtttgcattc
tttgcccagcacttcacgcatcagtttttcaagacagatcataagcgagggccagctttc
accaaaggcctgggccatggggtggacttaaatcatatttatggtgaaactctggacaga
cagcataaactgcgccttttcaaggatggaaagatgaagtatcagatcattgatggagag
atgtatcctcccacagtcaaagatactcaggccgagatgatctaccctcctcaagttcct
gagcatctgcggtttgccgtgggacaggaagtctttggtctggtgcctggtctgatgatg
tatgccacaatctggctgagggagcacaacagagtgtgcgatgtgcttaaacaggagcat
ccagaatggggtgatgagcagttgttccagacaagcagactaatactgataggagagact
attaagattgtgattgaagactatgtacagcacttgagtggctatcacttcaaacttaaa
tttgacccagaactacttttcaacaaacaattccagtaccaaaatcgtattgctgctgag
tttaataccctctatcactggcatccccttctgcctgacacctttcaaattcatgaccag
aactacaactatcaacagtttatctacaacaactctatgttactggaacatggagttacc
cagtttgttgaatcattcaccaagcaaattgctggcagggttgctggtggtaggaatgtt
ccacctgcagtaaaaaaagtatcacaggcttccattgaccagagcaggcagatgaaatac
cagtcttttaatgagtaccgtaaacgctttatgctgaagccctatgaatcatttgaagaa
cttacaggagagaaagaaatggctgcagagctgaaagcactctatggtgacattgatgca
atggagctgtatcctgcccttctggtagaaaagcctcgtccagatgccatctttggtgag
actatggtagaagttggagcaccattctccttgaaaggacttatgggtaatgtcatatgt
tctcccgcctactggaagccaagcacttttggtggagaagtgggtttcaaaatcatcaac
actgcctcaattcagtctctcatctgcaataacgtgaaaggctgtccctttacttcattc
agtgttccagatccagagctcatcaaaacagtcaccattaatgcaagttcttcccgctcc
agactagatgatatcaatccaacagtactactaaaagaacgttcgactgaactgtag

DBGET integrated database retrieval system