KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027698
Entry
101027698         CDS       T04350                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04152  AMPK signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101027698 (LEPR)
   04152 AMPK signaling pathway
    101027698 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101027698 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    101027698 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101027698 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101027698 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101027698 (LEPR)
   04090 CD molecules [BR:sbq04090]
    101027698 (LEPR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101027698 (LEPR)
CD molecules [BR:sbq04090]
 Proteins
  101027698 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 101027698
NCBI-ProteinID: XP_003921507
UniProt: A0A2K6T5Q0
LinkDB
Position
Unknown
AA seq 1165 aa
MICQKFCVVLLHWEFIYVITAYNLSYPITPWRFKLSCMPPNTTYDYFRLPAGLSKNTSDL
NGHYEKAVEVKFNSSGTHFSNLSKTSFHCCFWSEQDKNSSLCADNIEGKTFFSTVNSLVF
QQIGANWNIQCWLKGDLKLFICNVESLFKNQFKNYNHKVHLLYVLPEVLEDSPLVPQKGS
FQIVQCNCSVHKCCECPVSVPTAKLNDTLLMYLKITSGGVIFQSPLMSVQPINVVKPDPP
LGLHMEITDDGNLKISWSSPPLVRFPLQYQVKYSENSSTVIREADKIALATSLLVDSVHP
GSSYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVESNVSFHCIYKNENKI
VSSEKIVWWMNLAEKIPQSQYDVVSDHVSKVTFYNLNATKPRGKFTYDAVYCCSEHECHH
RYAELYVIDVNINISCETDGNLTKMTCRWSPNTIQSLAGSTLQLRYYRSRLYCSDSPSIH
PISEPKDCHLQRDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPNSVVKPLPP
SSVKAEITVKTGLLKISWENPVFPETNLQFQIRYGLSGKEVQWKIHEVYDAKSKSVSLPV
PDICAVYVVQVRCKRLDGLGYWSNWSSPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKRDSLCSVQRYVINHHTSLNGTWSEDVGNHTKYTFLWTEQEHTVTVLAINSI
GDSVANLNLTFSWPMSKVNIVQSLSAYPLNSTCVILSWMLSPSDYKPMSFIIEWKNLNED
DEIKWLRISSSVKKCYIHDHFIPIEKYQFSLYPIFTEGVGKPKIINSFTQDDIEKHQNDA
GLYVIVPVIISSFILLLGTLFISHQRMRKLIWEDVPNPKKCSWAQGLNFQKPETFEHLFI
KHTESVIFRPLLLEPEAISEDISVDTSWKNKDEMVPTTVVSLLPTTDLEKGSVCISDQFN
SANISEAEGTEVTSEEESRRQPFVKYATLVSNSKLGETDEEQGLINSSVSKCFSSKNYPL
KDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDEKSIYYL
GVTSIKKRECDMLLTDKSRVLCPFPAPRLFTDIRVLQDSCSQFVENNFNLGISSKKTFVS
YMPQFQTCSTQTRKIMENKMCDLTV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggaatttatttatgtgataact
gcatataacttgtcatacccaattactccttggagatttaagttgtcttgcatgccacca
aatacaacttatgactacttccgtttgcctgctggactctcaaagaatacttcagatttg
aatggacattatgagaaagctgttgaagttaagtttaattcaagtggaacccacttttct
aacttatccaaaacaagtttccactgttgcttttggagtgagcaagataaaaactcctcc
ttatgtgcagacaacattgaaggaaagacatttttttcaacagtaaattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggctaaaaggagacttgaaattattc
atctgtaatgtggagtcattatttaagaatcaattcaagaattataaccataaggtccat
cttttatatgttctgcctgaagtattagaagattcacctctggttccccagaaaggcagt
tttcagattgttcagtgcaactgcagtgttcacaaatgttgtgaatgtcctgtgtctgtg
ccaacagccaaactcaacgacactcttctcatgtatttgaaaatcacatctggtggagta
atttttcagtcacctctaatgtcagttcagcccataaatgtggtgaagcctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcttggtccagccca
ccattggtacgatttccacttcaatatcaagtgaaatactcagagaattcttcaacagtt
atcagagaagctgacaagattgccttagctacatctctgctggtagacagtgtgcatcct
gggtcttcatatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtactcctcatgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgagtctaatgtttcttttcactgcatctataagaatgaaaacaagatt
gtttcctcagaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgttagtgatcatgttagcaaagttactttttacaatctgaatgcaaccaaa
cctcgaggaaaatttacgtatgacgcagtgtactgctgcagtgaacacgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatggg
aacttaactaaaatgacttgcagatggtcacccaatacaatccaatcacttgcaggaagc
actttgcaattgaggtattatcggagcagactttactgttctgatagtccatctattcat
cccatatctgaacccaaagattgccatttgcagagggatggtttttatgaatgcattttc
cagccaatctttctattatctggctatacaatgtggattaggatcaatcactctctgggt
tcacttgactctccaccaacatgtgtccttcctaattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactgtaaaaactggattactgaaaatatcttgggaaaac
ccagtctttccagagactaatcttcaattccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatacatgaggtttatgatgcaaaatcaaaatctgtcagtctaccagtt
ccagacatctgtgcagtctatgttgttcaagtgcgctgtaagaggctagatggacttgga
tactggagtaattggagcagtccagcctacacggttgtcatggatataaaagttcctatg
agaggacctgaattttggagaataattaatggagacactatgaaaaaggagaaaaacgtc
actttactttggaagcccctgatgaaaagagactcattgtgcagtgtccagagatatgtg
ataaaccatcatacttccctcaatggaacatggtcagaagatgtgggaaatcacactaaa
tacaccttcctgtggacagagcaagagcatactgttacagttctagccatcaattcaatt
ggtgattctgttgcaaatttgaatttaaccttttcatggcctatgagcaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcacttgtgtgattctttcctggatgcta
tcacccagtgattacaagccaatgtcttttattattgagtggaaaaatcttaacgaagat
gatgaaataaaatggcttagaatctcttcatctgttaagaagtgttatatccatgatcat
tttattcccatcgagaagtaccagttcagtctttacccaatatttacggaaggagtggga
aaaccaaagataatcaatagcttcactcaagatgatattgaaaaacatcaaaatgatgca
ggtttatatgtaattgtgccagtaattatttcctctttcatcttactacttggaacacta
ttcatatcacaccaaagaatgagaaagctgatttgggaagatgttccaaatcccaagaag
tgttcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatc
aagcatacagaatcagtgatatttcgtcctcttcttttggagcctgaagcaatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagatggtgccaacaactgtggtc
tctctccttccaacaacagatcttgaaaagggttctgtttgtattagtgaccagttcaac
agtgctaacatctctgaggctgagggtaccgaggtaacctctgaggaagagagccgaaga
caaccctttgttaaatatgccacgctggtcagcaactctaaactaggtgaaactgatgaa
gaacaagggcttataaatagttcagtgagcaagtgcttctctagcaaaaattatccactg
aaggattctttctctaatagctcatgggaaatagaggcacaggcattttttatattatca
gatcagcatcccaacataatttcaccacacctcacattctcagaaggattggatgaactt
ttgaaactggagggaaatttccctgaagaaaataatgacgaaaagtctatctattattta
ggggtcacctcaatcaaaaagagagagtgtgatatgcttttgactgacaagtcaagggta
ttgtgccctttcccagccccccgtttattcacggatatcagagttctccaggacagttgc
tcacagtttgtagaaaataatttcaacttaggaatttctagtaagaagacttttgtatct
tacatgcctcaattccaaacttgttctactcagactcgtaagatcatggaaaacaagatg
tgtgacctaaccgtgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027739
Entry
101027739         CDS       T04350                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101027739 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101027739 (IL22RA2)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101027739 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind SCPU
Other DBs
NCBI-GeneID: 101027739
NCBI-ProteinID: XP_003926927
UniProt: A0A2K6UBQ7
LinkDB
Position
Unknown
AA seq 230 aa
MMPKHCFLGFLVSFFLTGVAGTQPAHESLKPQRVRFQSRNFHNILQWQPGRALTGNSSVY
FVQYKMYGQRQWKNKEDCWGIQELFCDLTNETSDIQEPYYGRVKAASAGSYSDWSLTPRF
TPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKTVSIEDYYALVYRVFIINNSL
EKEKKVYEGTHRVVEIEALTPHSSYCVVAEIYQPMLNRSQRSEERCVETP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatgcctaaacattgctttctaggcttcctcgtcagtttcttcctgactggtgtagca
ggcactcagccagcccatgagtctctgaagcctcagagggtacgatttcagtcccgaaat
tttcacaacattttgcaatggcagcccgggagggcacttaccggcaacagcagtgtgtat
tttgtgcagtacaaaatgtatggacagagacaatggaaaaataaagaggactgttggggt
attcaagaactcttttgtgaccttaccaatgaaacctcagacatacaggaaccttattac
gggagagtgaaggcggcctcagctgggagctactcagactggagcctgacgccacggttc
actccctggtgggaaacaaaaatagatcctccagttatgaatataacccaagtcaatgga
tcgttgttggtaattctccatgctccaaatttaccatatagatatcaaaaggaaaaaact
gtatctatagaagattactatgcattagtataccgagtttttataataaacaattcacta
gaaaaggagaaaaaggtttatgaagggactcacagagttgttgaaattgaagctctaaca
ccacactccagctactgtgtcgtggctgaaatatatcagcccatgttaaacagaagtcag
agaagtgaagagagatgtgtggaaactccatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029979
Entry
101029979         CDS       T04350                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101029979 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101029979 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101029979 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101029979 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101029979 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029979 (IL6ST)
   05203 Viral carcinogenesis
    101029979 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101029979 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029979 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101029979 (IL6ST)
   04090 CD molecules [BR:sbq04090]
    101029979 (IL6ST)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101029979 (IL6ST)
CD molecules [BR:sbq04090]
 Proteins
  101029979 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2
Other DBs
NCBI-GeneID: 101029979
NCBI-ProteinID: XP_003925890
UniProt: A0A2K6UU39
LinkDB
Position
Unknown
AA seq 919 aa
MLTLQTWLVQALFIFLTTESIGELLDPCGHISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITV
ISGLAPEKPENLTCIVNEGKKMMCQWDPGRETHLETNFTLKSEWATHKFPDCIAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGNVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPGIKSVITLKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKTDPSHTRGNRTVQLMWKTLPPFEAN
GKILDYEVTLTRWKSRLQNFYTVNDTKLTANLTSDHYVATLTARNLVGKSDAAVLTIPAC
DFQATRPVMDLKAFPKDNMLWVEWTTPRESVKKYVLEWCVLSDTSPCITDWQQEDGTVHR
TYLRGNLAESKCYVITVTPVYADGPGRPQSIKAYLKQAPPSKGPTVRTKKVGKNEAVLEW
DQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEG
GKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPS
KSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKI
NTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSR
SESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSS
VNEEDFVRLKQQISDRISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVAMEAAIDE
GMPKSYLPQTVRQGGYMPQ
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
ataggtgaacttctagatccatgtggtcatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgcgaattacattttctggaaaacaaaccattttactattcctaaggaacaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacatttggacagcttgaacagaatgtttatggaatcacagta
atttcaggcttggctccagaaaaacctgaaaatttgacttgcattgtgaatgagggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttcctgattgcatagcaaaacgtgacacccctacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcgcttgggaatgtcacatcagatcacatcaattttgatcctgtatataaagtg
aaacccaatccaccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaactgacgtggaccaacccaggtattaagagtgtaataacactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagatacagcatccacc
cgatcttcattcactgtccaggaccttaagcctttcacagaatatgtatttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccgagtttctggtataaaacagatccatcccat
actcgtggcaatagaactgtacaactcatgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacgtttacaaaatttt
tacacagttaatgacacaaagctgacagcaaatcttacaagtgatcactatgtagcaacc
ctaacagcaagaaatcttgttggcaaatcagatgcagctgttttaactattcctgcctgt
gactttcaagctactcgccctgtaatggatcttaaagcattccccaaagataacatgctt
tgggtagaatggactactccaagggaatctgtaaagaaatatgtacttgagtggtgtgtg
ttatcagatacatcaccctgtatcacagactggcaacaagaagatggtaccgtgcatcgc
acctatttaagagggaacttagcagagagcaaatgctatgtgataacagttactccagta
tatgctgatggaccaggaaggcctcaatccataaaggcataccttaaacaagccccacct
tccaaaggacctactgttcggacaaaaaaagtagggaaaaatgaagcggtcttagagtgg
gaccaacttcctgttgatgttcagaatggatttatcagaaattacactatattttataga
accatcattggaaatgaaaccgctgtgaatgtggattcttcccacacagaatatacattg
tcctctttgactagtgacacattgtacatggttcgaatggcagcatacacagatgaaggt
gggaaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaa
gccatagtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgttgttc
tgctttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccctca
aagagtcatattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaa
gatcaaatgtattcagatggcaatttcaccgatgtaagtgttgtggaaatagaagcgaat
gacaaaaagccttttccagaagatctgaaatcactggacctattcaaaaaggaaaaaatt
aataccgaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggcca
agcatttctagcagtgatgaaaatgagtcttcacaaaacacttcgagtactgtccagtat
tctactgtggtacacagtggctacagacaccaagttccatcagtccaagtattctcaaga
tccgagtccacccagcccttgttagattcagaggagcggccagaagatcttcaattagta
gatcatgtagatggtggtgatggcattttgcccaggcaacagtacttcaaacagaactgc
agtcagcatgaatccagtccagatatttcacattttgaaaggtcaaagcaagtgtcatca
gtcaatgaggaagattttgttagacttaaacaacagatttcagatcgtatttcacaatcc
tgtggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtcca
gggactgagggacaagtagaaagatttgaaacagttgcgatggaggctgcaattgatgaa
ggaatgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030332
Entry
101030332         CDS       T04350                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101030332 (IL2RB)
   04151 PI3K-Akt signaling pathway
    101030332 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101030332 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101030332 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101030332 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101030332 (IL2RB)
   04659 Th17 cell differentiation
    101030332 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030332 (IL2RB)
   05202 Transcriptional misregulation in cancer
    101030332 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101030332 (IL2RB)
   05162 Measles
    101030332 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101030332 (IL2RB)
   04090 CD molecules [BR:sbq04090]
    101030332 (IL2RB)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101030332 (IL2RB)
CD molecules [BR:sbq04090]
 Proteins
  101030332 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind Sox17_18_mid
Other DBs
NCBI-GeneID: 101030332
NCBI-ProteinID: XP_003932941
UniProt: A0A2K6SGJ3
LinkDB
Position
Unknown
AA seq 551 aa
MAAPALSWCLPLLALLLSLATPWASAAVNGTSQLTCFYNSRANISCVWSQAEALQDTPCQ
VQARPDKRPWNQTCELLPVSQASRACSLILGPPDSQKLTSADIVNLKVMCREGARWRMMT
TQDFEPFENFRLMAPISLRVVYMGTHECNISWEISQASHYFERKLESEARMLSPGRTWEE
ASLLTLKQQQEWIVLEMLTPDTHYELQVRVRPLRGKYTTWSPWSQPVTFRTRPAAPGKDT
LPWPGHLLVGVSGACGFILLVYLLVNCRNTRPWLKKVLKCHIPDPSKFFSQLSSEHGGDL
QKWLSSPFPSSSFSPGSLTPEISPLEVLESDKVTQLLLQQAKAPEPAPSGSKRSLTSCFT
NQGYFFFRLPDALEIEACQVYFTYDPCTEEEPDEGGAGAPTGSSSHPLWPLSGEDDAYCT
FPPGDDLLLFSPSLLSGPSPPNTALGSSGASEERLPPSLQERVPRDWDPQPLRPPTPGVP
DLVDFRPPAELVLREAGEEVPDPGHRERADFPWASPPGQSQVRVLNCRLPLNTDAYLSLQ
ELQDQDPGHLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggccgcccctgctctgtcctggtgtctgcccctcctcgccctcctcctgtccctggcg
accccttgggcatccgcagcggtgaatggcacctcccagctcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagccgaggctctgcaggacaccccctgccaa
gtccaggccaggccggacaaacggccgtggaaccaaacctgtgagctgctccctgtgagc
caggcatcccgggcctgcagcctcatccttggaccccccgattctcagaaattgacctca
gcggacattgtcaacctgaaggtgatgtgccgtgaaggggcgcgatggaggatgatgacc
actcaggacttcgaaccctttgagaactttcgcctgatggcccccatctccctccgagtc
gtctacatggggacccacgaatgcaacataagctgggaaatctcccaagcctcccactac
ttcgaaagaaaactggagtcagaggcccggatgctgtccccaggccgcacctgggaggag
gcctccctgctgaccctcaagcaacagcaggaatggatcgtcctggagatgctcacccca
gacacccactatgagcttcaggtgcgagtcaggcctctacgaggcaagtacacgacctgg
agcccctggagccagcccgtgaccttccggacgaggcctgcagcccctgggaaggacacc
ctcccttggcccggccacctccttgtgggcgtcagcggggcctgtggcttcatcctcttg
gtctacttgctggtcaactgcaggaacaccagaccatggctgaagaaggtcctgaaatgt
cacatcccagacccctcgaagttcttttcccagctgagctcagagcatggaggagatctc
cagaagtggctttcctcgcccttcccctcatcgtccttcagccctggcagcctgacgcct
gagatctcgccgctggaagtgctggagagcgacaaggtgacgcagctgctcctgcagcag
gccaaggcgcccgagcccgcaccctcaggcagcaagcgctcgctgaccagctgcttcacc
aaccagggctacttcttcttccgcctcccggacgccctggagatcgaggcctgccaggtg
tacttcacttacgacccctgcacggaggaggagcctgatgagggtggggccggggcgccc
acagggtcgtcctcccatccgctgtggcctctgtcaggggaggacgatgcctactgcacc
ttccccccgggggatgacctgctgctcttctcccccagtctcctcagtggccccagcccc
ccaaacactgcccttgggagcagcggggccagtgaagaaaggctgcccccttccttgcag
gagagagtccccagagattgggacccccagcccctgaggcctcccaccccaggagtccca
gacctggtggattttcggccacccgcagagctggtgctgcgagaggcaggggaggaggtc
cctgaccctggccacagagagagggctgatttcccctgggccagtcctcctgggcagagc
caggtcagggtccttaactgtcgcctgcctctgaacaccgatgcctacttgtccctccaa
gaactccaagatcaggacccaggtcacttggtgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032072
Entry
101032072         CDS       T04350                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X2
  KO
K05067  interleukin 5 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032072 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032072 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101032072 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032072 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101032072 (IL5RA)
   04090 CD molecules [BR:sbq04090]
    101032072 (IL5RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101032072 (IL5RA)
CD molecules [BR:sbq04090]
 Proteins
  101032072 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101032072
NCBI-ProteinID: XP_003927184
LinkDB
Position
Unknown
AA seq 392 aa
MSTDWNKRIVFRQDMIIMAPILLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQV
LLHWEPNPDQEQRNVNLEYQVKINAPKEDDYETRITESNCVTILHQGFSASVRTILQNDH
SFLASSWVSAEVQAPPGSPRTSALNLTCTTNTTADNYSHLRPYQVSLHCTWLVGTDAPED
TQYFLYYRYGSWTEECKEYSKDILERNIACWFPRTFIHSRGRDWLVVLVNGSSKHTTIKP
FDQLFALHTIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQI
EKMMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEQKPLRKWFLFV
LMATICLILLILSLICRTKLDPLRQKLKSSVI
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagtactgattggaacaagaggattgtctttagacaggatatgatcatcatggcacct
atattactgattcttttgggggccactgagatactgcaagctgacttacttcctgatgaa
aagatttcacttctcccacctgtcaattttaccattaaagttactggtttggctcaagtt
cttttacattgggaaccaaatcctgatcaagagcaaagaaatgttaatctagaatatcaa
gtgaaaataaacgctccaaaagaagatgactatgaaaccagaatcactgaaagcaactgt
gtaaccatcctccaccaaggcttttcagcaagtgtgcggaccatcctgcagaacgaccac
tcatttctggccagcagctgggtttctgctgaagttcaggctccaccagggtctcccaga
acctcagctttgaatttaacctgcaccacaaacactacagcagataattattcacattta
aggccataccaagtttcccttcactgcacctggcttgttggcacagatgcccctgaggac
acgcagtattttctctactacaggtatggttcctggactgaagaatgcaaagaatacagc
aaagacatactggagagaaatattgcatgctggtttcccaggactttcatccacagcaga
gggcgtgactggcttgtggttcttgttaatggctccagcaagcacactaccatcaagccc
tttgatcagctgtttgcccttcacaccattgatcaaataaatcctccactgaatgtcaca
gcagagattgaaggaactcgtctctctatccaatgggagaaaccagtgtctgcctttcca
atccattgctttgattatgaagtgaaaatacacaatacaaggaatggatatttacagata
gaaaaaatgatgaccaatgcattcatctcaataattgatgatctttctaagtacgatgtt
caagtgagagcagcagtgagctccatgtgcagagaggcagggctctggagtgagtggagc
caacctatttatgtaggaaatgatgaacagaagcccttgagaaaatggtttctctttgtg
cttatggcaaccatctgcttgatcttgttaattctctcgctcatctgtagaacaaagctg
gatccactgagacagaaactgaagtcatcagttatatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032718
Entry
101032718         CDS       T04350                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1
  KO
K05063  interleukin 12 receptor beta-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032718 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032718 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101032718 (IL12RB1)
   04659 Th17 cell differentiation
    101032718 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032718 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101032718 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101032718 (IL12RB1)
   04090 CD molecules [BR:sbq04090]
    101032718 (IL12RB1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101032718 (IL12RB1)
CD molecules [BR:sbq04090]
 Proteins
  101032718 (IL12RB1)
SSDB
Other DBs
NCBI-GeneID: 101032718
NCBI-ProteinID: XP_010328508
LinkDB
Position
Unknown
AA seq 521 aa
MWPLVTWRVPLLPLLLLLFRQGAACRTSECCFQDPPYPDGDSGSASGPKDLSCYRIPSAG
YECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLRFSDQARVPVLCTVTLWVESRA
RNQTEKSTSVTLQLYNSVRYEPPLGDIKVSKSAGQLRLEWETPDRQVGAEVQFRHRTHSG
PWTLGDCGPQDGDTESCLCPLEMNVAQEFQLRRRYRENQGSLWSKWSSPVCIPPENPPPP
QVRFSVEQLGRDGRRRLTLKEQPTQLELPEGCRGLASGAEVTYRVRLHMLSCPCKAKATR
TVHLGKTLNLSGAAYNVTVISWNRFGPGPNQTWHIPADTHTATYSWSREFGAMKQEKCYY
ITILASARPEKLTLWATVLSAYHFGGNEAQGSDWFIFVASLGSFLSILLVGILGYLSLNR
AARHLCPPLPTPCASSAIEFPGGKETWQWIHPADLQEEASLQEALVVELSWDKGGGTEAL
EKTEQPEGAPELALDTELSLEDGDRCKAKVLGLSEPDGQRC
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtggccgctggtgacctggagggtccccctcctccccctcctcctcctgctgttcagg
cagggcgctgcctgcagaaccagcgagtgctgttttcaagacccgccatatccggacgga
gactcaggctcagcctccggccccaaggacctgagctgctatcggatacccagcgctggt
tatgagtgctcctggcagtatgagggtcccacggctggggtcagccacttcttgaggtgc
tgccttagctccgggcgctgttgctactttgcggcaggctcagccacccggctacgtttc
tccgaccaggccagggtgcctgtgctctgcactgttacactctgggtggaatcccgggcc
aggaaccagacagagaagtctactagtgtgaccctgcagctctataactcagttagatac
gagcctcctctgggagacatcaaggtgtccaagtcggccgggcagctgcgtctggagtgg
gagaccccagacagacaggttggtgctgaggtgcagttccggcaccggacacacagcggc
ccgtggacgttgggtgactgcggacctcaggatggtgatactgagtcctgtctctgcccc
ctggagatgaatgtggcccaggaattccagctccgaagacggtaccgggagaaccaggga
agtctctggagcaagtggagcagccctgtgtgcattccccccgaaaaccccccaccacct
caggtgaggttctcggtggagcagctcggccgggatggcaggaggcggctgactctcaaa
gagcagccaacccagctggagcttccagaaggctgtcgagggctggcgtctggcgccgag
gtcacctaccgagtgcgtctccacatgctgtcctgcccctgtaaggccaaggccaccagg
accgtgcatctggggaaaacgctcaatctctcgggtgctgcctacaacgtgactgtcatc
tcctggaaccgatttggtcctggcccgaaccagacgtggcacattcctgctgacacccac
acagcaacctacagctggagtcgagagtttggggcgatgaagcaggaaaagtgttactac
attaccatcttggcctctgcgcgcccggagaagctcaccttgtgggctacggttctgtct
gcctaccactttggaggcaatgaagcgcagggttctgattggttcatcttcgtcgcctcc
ctggggagcttcctgagcatccttctcgtgggcatcctcggttacctcagcctgaacaga
gccgcacggcacctgtgcccacccttgcccacaccctgtgccagctctgccattgagttt
cccggagggaaggagacttggcagtggatccacccggcggacttgcaggaagaggcatcc
ttgcaggaggccctggtggtggagctgtcctgggacaaaggcgggggcactgaagctctc
gagaagacagagcaacctgagggtgcccctgagctggccctggatacagagctgtccttg
gaggatggcgacaggtgtaaggccaaggtcctggggctcagtgagccggatggtcagagg
tgctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032801
Entry
101032801         CDS       T04350                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032801 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032801 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101032801 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032801 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101032801 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101032801 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101032801 (IL10RA)
   04090 CD molecules [BR:sbq04090]
    101032801 (IL10RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101032801 (IL10RA)
CD molecules [BR:sbq04090]
 Proteins
  101032801 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101032801
NCBI-ProteinID: XP_003923694
UniProt: A0A2K6UEN5
LinkDB
Position
Unknown
AA seq 579 aa
MLPRLAVLLAALLSLRPGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTFYEVE
LLRYGIEHWKLIPTCGQTLMLSCDLTAVTLDLYHSSGYRARVRAVNSTQHSNWTVTNTRF
SVDEVTLTVGSVKLEIHNGLILGRIQPPRPKMAPAGVTYESIFSHFREYEIAIRKVPENF
TFTHEKLKHENFSLQTSGEVGEFCIKVKPSISSRTNKGMWSKEECISLTRQYFTVTNIII
IFAFVLLSGALACCLALQLYVRHRRKLPSVLLFKKPSPFILGSQPPCPETQDTIHPLDEE
AFLKVSPELRNLDLHGSTDSGFGSNKPSLQTEEPQFLLSDPHPQANRTLGSGEPPELGDS
CGSDSSNSTDSGICLQERSLSPGTRPVWEQQVGSDSRDQDDSGIGLVQNSEGQAGDTQGG
PALDHSSPPETEVPGEEDPAAVAFRGYLRQTRCTEEKATKTGCLEEESPLTDGLGPKFRA
CLDDEEGWHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSNCGDLGTSDW
SFAHNLASLGCLAAQGGLLGSFNSDLVTLPLISSLHSNE
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgctgccgcgcctcgctgtgctgctggcggcgctcctcagcctccgcccaggctcggac
gctcacgggacagaactgcccagccctccgtctgtgtggtttgaagcagaatttttccac
cacatcctccactggactcccatcccaaatcagtccgaaagtaccttctatgaagtggaa
ctcctgaggtatggaatagagcactggaagctcatccccacttgcggacagaccctgatg
ctgtcctgtgacctcaccgcggtgaccctggacctgtaccacagcagtggctaccgggcc
agagtgcgggctgtgaacagcacccagcactccaactggaccgtgaccaacacccgcttc
tccgtggatgaagtgactctgacagttggcagtgtgaagctagagatccacaatggcctc
atccttgggaggattcagcccccgaggcccaagatggcccctgcaggtgtcacatatgaa
agcatcttcagtcacttccgagagtatgagattgccattcgcaaggtgccggaaaacttt
acgttcacacacgagaaattaaaacatgaaaacttcagcctccaaacctctggagaggtg
ggagagttctgcatcaaggtgaaaccatctatcagttcccgaactaacaaggggatgtgg
tctaaagaggagtgcatctccctcaccaggcagtatttcaccgtgaccaacatcatcatc
atctttgcctttgtcctgctctccggagccctggcctgctgcctggccctccagctgtat
gtgcggcaccgaaggaagctgcccagtgtcctgctcttcaagaagcccagccccttcatc
ctcggcagccagccaccctgtccagagacccaggacaccatccacccacttgacgaggag
gccttcctgaaggtgtccccagagctgaggaacttggatctgcatggcagcacggacagt
ggctttggcagtaacaagccatccctgcagaccgaagagccgcagttcctcctctctgac
ccccacccccaggccaacagaacgctgggtagtggggagccccctgagctgggggacagc
tgcggtagtgacagcagcaacagcacagacagtgggatctgcctgcaggagcgcagcctg
agccctggcacacggcctgtctgggagcagcaggtggggagtgacagcagggaccaggat
gacagtggaattggcctagttcaaaactctgagggacaggctggggacacacagggtggc
ccagccttggaccacagcagtccgccagagactgaggtgcctggggaagaagatccagct
gctgtggcattccggggctacctgaggcagaccagatgcactgaggagaaggcaaccaag
acaggctgcctggaggaagaatcccccttgacagatggccttggccccaaattcagggca
tgcctggatgatgaggaaggctggcatccaccagccctggccaagggctatttgaaacag
gatcccctagaaatgacgctggcttcctcaggggccccaactggacagtggaaccagccc
actgaggaatggtcactcctggccttgagcaactgtggtgacctgggaacatctgactgg
agtttcgcccataaccttgcctctctaggctgtctggcagcccaaggtggtctcctgggc
agctttaactcagacctggtcaccttgcccctcatctccagcctgcactcaaatgagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033804
Entry
101033804         CDS       T04350                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta isoform X2
  KO
K04738  cytokine receptor common subunit beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101033804 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101033804 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101033804 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033804 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101033804 (CSF2RB)
   04090 CD molecules [BR:sbq04090]
    101033804 (CSF2RB)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101033804 (CSF2RB)
CD molecules [BR:sbq04090]
 Proteins
  101033804 (CSF2RB)
SSDB
Motif
Pfam: Tissue_fac fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101033804
NCBI-ProteinID: XP_003932953
UniProt: A0A2K6SQZ2
LinkDB
Position
Unknown
AA seq 898 aa
MVLARGLLRMALLALCWGHSLAGEQETVPMQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNQDPPEPVSCDLSDDMPWSACPHPHCVPRRCVIPYQSFVSSDTDRFSFTPDKPLG
AQLTVTLTQHVQPPAPKDLQIRSHQDHFLLTWSVALAPQSQWLSQGDLEFEVVYKRLQDS
WEDAATLLSNASHATLGPEHLMPSSTYVARVRTRLAPGSQLSGRPSEWSPELRWDSQPGD
EAQPQNLQCFFDGAAVLSCSWEVRREVVSSVSFGLFYKPSPDVGEKECSPVLREEFGSLH
IRHHCGIPVPDPSTHGQYIVSVQPRTPEKHIKSSEHIQMAPPSLTVSKVGDSYSLHWKAM
KMQYEHIDHKFEIQYRRNSTTWEDSKTETLWNAHSMALPALEPSTTYWARVRVRTFRSGY
DGIWSQWSEERSWETEWALPVWVLPLVVVLLTLAVLVALRFCGIYGYRLSRKWEERIPNP
SKSHLFQNRIAERQPPGSMAAFASRSPREQGPWDSHFSELEGVFLVGFKDSEVSPLTTED
PKHVCDPPSGPDTTPAASDLPTEQPPSPRPGPPAPSHTPENQASSFDFNGPYLGSPQSHS
LPDSLCQPEPPQAGGSQKPPPPGSLEYLCLPAGGQVRLVPLAQLMGQGQGQAVDVERRLS
QGAAGSPSLESGGGPAPPALTTGVGRQDPEDSPGALPTSSKDPEDPGVASGYVSSADLVF
PPQSGASPVSLVPSLDLPADHTPSFCPELAAEHPGTPGPVKSGFEGYVELPPTEAQSTRS
PLNNLVPPEASSPVRNPGEHRADVSPASPHSEGLLVLQQVGEYCFLPGLGAGPVSPRSKP
SSPGPCPEIRDSDQALQVKKPPGQAMPQVPVIQLFKALKQQDYLSLPPWEVSRPGEVC
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggtgctggcccgggggctgctccgcatggccctgctggccctgtgctgggggcacagc
ctggcgggggaacaagaaaccgtcccaatgcagacgcttcgctgctacaatgactacacc
agccacatcacctgcaggtgggcggacacacaggacgcccagcggcttgtcaatgtgacc
ctcattcgccgggtgaatcaggaccctccagagccagtgtcctgcgacctcagtgatgac
atgccctggtcagcctgcccgcatccccactgcgtgcccaggagatgtgtcattccctac
cagagttttgtcagctctgacactgaccgcttctcattcacaccagacaagcctctgggc
gcccagctcaccgtcactctgacccagcatgtccagcctcctgcacccaaggacctgcag
atccgtagccaccaggaccacttcctgctgacctggagtgtggccctggcgccccagagc
cagtggctgtcccagggggacctggagtttgaggtggtctataagcggctccaggactct
tgggaggatgcggccaccctcctctccaatgcctcccatgccaccctggggccagagcac
ctcatgcccagcagcacctacgtggcccgcgtgcggacccgcctggccccaggttcgcag
ctctcaggacgtcccagtgagtggagcccagagttgcgctgggactcccagccaggggat
gaggcccagccccagaacctgcagtgcttcttcgacggggctgccgtgctcagctgctcc
tgggaggtgaggcgggaggtggtcagctccgtctccttcggcctcttctacaagcccagc
cccgacgtaggggagaaagagtgctccccagtgctgagggaggagttcggcagcctccac
atcagacaccactgtgggattcctgtgcccgaccccagcacccacggccagtacatcgtc
tccgttcagccaaggacgccagagaaacacataaagagctccgagcacatccagatggcg
cctccgtccctcactgtgagcaaggtaggagacagctacagcctgcactggaaagcaatg
aaaatgcagtacgagcacatagaccacaaattcgagatccagtacaggagaaactcgacc
acgtgggaggacagcaagaccgagaccctctggaacgcccacagcatggccctgccagcc
ctggagccctccaccacgtactgggccagggtgagggtcaggaccttccgcagcggctac
gatgggatctggagccagtggagtgaggagcgctcctgggaaaccgagtgggcgctgccc
gtgtgggtgctgccgctcgtcgtggtgctcctcaccctcgctgtgctcgtggccctccgc
ttctgtggcatctatgggtacaggctgagcagaaagtgggaggagaggatccccaacccc
agcaagagccacctgttccagaaccggattgcagagcggcagcctccaggcagcatggca
gcctttgccagcaggagcccccgggagcaggggccgtgggacagccacttctctgagctg
gagggggtgttccttgtaggattcaaggatagtgaggtgtcacctctcaccacagaggac
cccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagacctg
cccacagagcagccccccagcccccggccaggcccacctgccccctcccacacgcctgag
aaccaggcttccagcttcgacttcaatggcccctacctggggtcgcctcaaagccactcc
ctgcctgacagcctgtgccagccagagcccccacaggcaggtgggagccagaagcccccg
cctccaggatccctggagtacctgtgtctgcccgctggggggcaggtgcggctggtcccg
ctggcccagttgatggggcaggggcagggccaggccgtggatgtggagaggaggctgagc
cagggggctgcggggagcccctccctggagtccgggggaggccctgcccctcctgctctt
accacaggggtgggaagacaggacccagaggacagccctggggctctgcccacgagctct
aaggaccctgaggaccccggagtggcctctggttacgtctcctctgcagatctagtattc
cccccccagtcaggggcctcacccgtctccctggttccctctctggacctccctgcagac
cacacccccagcttctgtcctgagctggccgctgaacaccctggaaccccaggccctgtg
aagtcagggtttgagggctatgtggagctccctccaactgaggcccagtccactaggtcc
ccactgaacaatcttgtcccccctgaggccagcagccctgtccggaacccaggggagcac
cgggcagatgtatccccagcatccccacactccgagggcctccttgtcctgcagcaggtg
ggcgagtattgcttcctccccggcctgggggctggccctgtctcaccccggagtaagccc
tcttccccgggaccctgtcctgagatcagggactcagaccaggctttgcaagtcaagaag
cccccgggccaggccatgccccaggtgcccgtcattcagctcttcaaagccctcaagcag
caggactacctgtcgctgcccccttgggaggtcagcaggcctggggaggtgtgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035044
Entry
101035044         CDS       T04350                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035044 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    101035044 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035044 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101035044 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101035044 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    101035044 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    101035044 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101035044 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035044 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101035044 (IFNAR1)
   05160 Hepatitis C
    101035044 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    101035044 (IFNAR1)
   05164 Influenza A
    101035044 (IFNAR1)
   05162 Measles
    101035044 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    101035044 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035044 (IFNAR1)
   05169 Epstein-Barr virus infection
    101035044 (IFNAR1)
   05165 Human papillomavirus infection
    101035044 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035044 (IFNAR1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IFN receptor family
   101035044 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101035044
NCBI-ProteinID: XP_003927702
UniProt: A0A2K6SNA4
LinkDB
Position
Unknown
AA seq 552 aa
MVALLGATTLVLVAVAPWVLPAAAGGKNLKSSQKVEVDIIDDNFILKWDRSDESLRSVTF
SFDYQKSGTDNWIKLPGCQNITSTKCNFSSVKLNVYEEMKLRIRAEKENTSSWYEVDPFT
PYNKAQIGPPEVHLEAEDKAIMIKISPPGTKNSVMWALDGSSFRYSLVIWKNSSSGEEEI
ENIYSIRKIYKLSPETTYCLKVKAALPVARKVGIYGPVYCIKTTVENELPPPENIEVSVQ
NQSCVLKWDYAYANVTFQVQWLHAFLKRNSMNHSYKWKQMPDCENVKTTQCVFPQNVFPK
GIYFLRVQASDGNNTSFWSEEIKFDTEIQAFLPPPVLKVKPIGDSLHIHIDAPKESGSKP
VNEDYPFTYEIIFWENTSNAERKFFKKETDFIVPNLKPLTVYCVKARAHTMDEKWNKSSA
FSDVVFVETKPGNASNIWLIAGICTAIIAIVAVIYVVKVLLRCINYVFFPSPKPSSNIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHEKYSSQNCQDSGNYSN
EDESESKTSEEL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggtcgccctcctgggggcgacgaccctggtgctcgtcgccgtggcgccatgggtgttg
cccgcagccgcaggtgggaaaaatctaaaatcttctcaaaaagtagaagtcgacatcata
gatgacaactttatcctgaagtgggacaggagtgatgagtctcttaggagtgtgactttt
tcattcgattatcaaaaatctgggacagataattggataaaattgcctgggtgtcagaat
attactagtaccaaatgcaacttttcttcagtcaagttgaatgtttatgaagaaatgaaa
ttgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgacccatttaca
ccatataacaaagctcaaattggtcctccagaagtacatttggaagctgaagataaggca
ataatgataaagatctctcctcctggaacaaaaaatagtgtcatgtgggctttggatggt
tcaagctttagatacagcttagttatctggaaaaactcttcaagtggagaagaagagatt
gaaaatatttattccatacgtaaaatttataaactttcaccagagactacctattgttta
aaagttaaagcagcactacctgtggcaaggaaagtcggtatctatggtccagtatattgt
ataaagaccacagttgaaaacgaactacctccaccagaaaatatagaagtcagtgttcag
aatcagagctgtgttctgaagtgggattacgcatatgcaaacgtgacctttcaagttcag
tggctccacgcctttttaaaaaggaattctatgaaccattcgtataaatggaaacaaatg
cctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaatgttttcccaaaa
ggaatttactttctccgtgtacaagcatctgatggaaataacacatctttttggtctgaa
gagataaagtttgatactgaaatacaagctttcctacctcctccagtccttaaagttaaa
cccattggtgattcattacatatccatattgatgctccaaaagagtcgggaagcaagcct
gtgaacgaggattatccattcacttatgaaattattttttgggaaaacacttcaaatgct
gagagaaaatttttcaagaaagaaacggattttattgttcctaatttgaaaccactgact
gtatattgtgtcaaagccagagcacacaccatggatgaaaagtggaataaaagcagtgct
tttagtgatgttgtgtttgtggaaacaaaaccaggaaatgcatctaatatttggcttata
gctggaatttgtactgcaataattgctatcgtagctgtcatttatgttgtaaaagttctc
ctgagatgcatcaattatgtgttctttccatcacctaaaccttcttccaatatagatgag
tatttctctgaacagccattgaagaatcttctgctttcaacttctgaagaacaaattgaa
aaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcaaact
gatgaagatcatgaaaaatacagttcccaaaactgccaggattcaggaaattattctaat
gaagatgaaagtgaaagtaaaacaagtgaagaactgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035136
Entry
101035136         CDS       T04350                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X1
  KO
K05056  interleukin 11 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035136 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035136 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101035136 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035136 (IL11RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101035136 (IL11RA)
SSDB
Motif
Pfam: Ig_3 Ig_2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101035136
NCBI-ProteinID: XP_010330023
LinkDB
Position
Unknown
AA seq 494 aa
MGQEPPYFTPLLPLVPGRSRPHCGGAGREGVEAGAEGEGRGRWRQRPRKGLPSPGSTASC
APRKHLVRNEKRMNSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQLGRSVKLCC
PGVIAGDPVSWFRDGEPRLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGTLGGTVILQ
LGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRKSPSPGPW
PCPQDPLGAARCVVHGAEFWSQYRINVTEMNPLGASTRLLDVSLQSILRPDPPQGLRVES
VPGYPRRLRASWTYPASWPRQPHFLLKFRLQYRPAQHPAWSMVEPAGLEEVITDAVAGLP
HAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEVPAGDQLHTQPEVEPQEDSPAPPRP
SFQPHPQLLDHRDSMEQVAVLASLGVLSFLGLVAGALALGLWLRLRQSGKDGSPKPGFLA
PMIPVDRRPGVPNL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgggccaggagcccccctatttcacccctctccttccattggtgcctgggcggagccgc
ccccactgcgggggcgcagggcgggagggagtagaggccggggcagagggcgagggcaga
gggcgctggcggcagcggccgcggaagggcctcccttcccctggaagcacagccagttgt
gccccaaggaaacatttggtgaggaatgaaaagaggatgaacagcagttgctcagggctg
agcagggtcctggtggccgtggctacagccctggtgtctgcctcctccccctgcccccag
gcctggggccccccaggggtccagtatgggcagctgggcaggtccgtgaagctgtgttgt
cctggagtaattgctggggacccagtgtcctggtttcgggacggggagccaaggctgctc
cagggacctgactctgggctagggcatgaactggtcctggcccaggcagacagcactgat
gagggtacctacatctgccggaccctggatggtacccttgggggcacagtgatcctgcag
ctgggctaccccccagcccgccctgttgtctcctgccaagcagccgactatgagaacttc
tcttgcacttggagtcccagtcagatcagtggtttacccacccgctacctcacctcctac
aggaagaagacagtcctaggagctgatagtcagaggaagagtccatctccagggccctgg
ccatgtccacaggaccccctaggggctgcccgctgtgtggtccatggggctgagttctgg
agccagtaccggattaatgtgactgagatgaacccactgggtgccagcacacgcctgctg
gatgtgagcttgcagagcatcttgcgccctgacccaccccagggcctgcgggtagagtcg
gtaccaggttatccccgacgcctgcgagccagctggacataccctgcctcctggccccgc
cagcctcacttcctgctcaagttccggctgcagtaccgtccggcgcaacatccagcctgg
tccatggtggagccagctggactggaggaggtgatcacagatgctgtggctgggctgccc
catgctgtacgagtcagtgcccgggactttctggatgctggcacctggagcacctggagc
cctgaggcatggggaactccgagcactgggactataccaaaggaggtaccagctggggac
cagctacatacacagccagaggtggagcctcaggaggacagccctgctcctccaagaccc
tcctttcagccacatcctcagctacttgatcacagggactctatggagcaggtagctgtg
ctggcgtctttgggagtcctttctttcctaggactggtggctggggccctggcactgggg
ctctggctgaggctgagacaaagcgggaaggatggatccccgaagcctgggttcttggcc
ccaatgattccagtggacaggcgtccaggagttccaaacctgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035236
Entry
101035236         CDS       T04350                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor isoform X1
  KO
K05079  erythropoietin receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035236 (EPOR)
   04151 PI3K-Akt signaling pathway
    101035236 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035236 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101035236 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035236 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035236 (EPOR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101035236 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 101035236
NCBI-ProteinID: XP_003941827
UniProt: A0A2K6SBI4
LinkDB
Position
Unknown
AA seq 509 aa
MGHLVASLWPQVGSLCLLLAGAACSSPPNLPDSKFDNKAALLAARGSEEFLCFTERLEDL
VCFWEEAASAGMGPDNYSFSYQLDNEPWKRCRLHQTPTARGVVRFWCSLPRADTSSFVPL
ELRVTVASSGALRYHRIIHVNEVVLLDAPVELAARLADESGHVVLRWLPPPGAPMPYHIR
YEVDVSSGSGAGSAQRVEILEGRTECVLSNLRRLTRYTFAVRARMAEPSFGGFWSAWSEP
VSLLTPTDLDPLILTLSVILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQNDGCLWWSPCTPFTEDPPVSLEVLSECCWETMQPVEPGTDDEGPQLEPV
GSEHAQDTYLVLDKWLLPQSPPSEDLPRPDSSMDIVAMDEGSEASSCTSALALKPSPEGA
SAASFEYTILDPSSQLLRPWELCLELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGG
SSDGPSSNPYENSLIPASESLPPSYVTCS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggccacctcgtggcatccctgtggccccaggtcggctccctttgtctcctgcttgct
ggggccgcctgttcatccccgcccaacctcccggactccaagttcgacaacaaagcggcc
ttgctggcggcccgcgggtccgaagagtttctgtgcttcaccgagcggctggaggactta
gtgtgtttctgggaggaagcggcgagcgccgggatgggcccggacaactacagcttctcc
taccagctcgacaatgagccatggaagcggtgtcgcctgcaccagactcccacggctcga
ggcgtggtgcgcttctggtgttcgctgcctagagccgacacgtcgagcttcgtgccccta
gaattgcgcgtcacagtagcctcctccggggctctgcgatatcaccgtatcatccacgtc
aatgaagtagtgctcctggatgcccccgtggagctggcagcgcggctggctgatgagagc
ggccacgtggtgttgcgctggctcccgccgcctggggcacccatgccgtaccacatccgc
tacgaggtggacgtctcgtcaggcagtggcgcagggagcgcgcagagggtggagattttg
gagggccgcaccgagtgcgtactgagcaatctgcggcgcctgacacgctacacattcgct
gtacgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtccgagcct
gtgtcgctgctgacgcctactgacctggaccccctcatcctgacgctctccgtcatcctc
gtgctcatcctggtgctgctgacagtgctcgccctgctctcccaccgccgggctttgaag
cagaagatctggcctggcatcccaagcccagagagcgagtttgaaggcctctttaccacc
cacaagggtaatttccagctgtggctgtaccagaatgacggctgtctgtggtggagcccc
tgcactcccttcacagaggacccacctgtctccctggaagtcctctccgagtgctgctgg
gagaccatgcagccagtggagccagggacagatgatgagggcccccagctggagccagtg
ggcagtgagcatgcccaggatacctatctggtgctggacaagtggttgctgccccagagt
cctcccagtgaggacctcccacggcctgatagcagcatggatatagtggccatggatgaa
ggctcagaagcatcctcctgcacatccgctttagccttgaagcccagcccagagggagct
tctgctgccagttttgagtacaccatcctggaccccagctcccagctcttgcgtccatgg
gaactgtgccttgagctgccccctaccccaccccacctaaagtacctctaccttgtggta
tctgattctggcatctcaactgactacagctcaggggactcccagggagctcaagggggc
tcatccgatggcccctcctccaacccttatgagaacagcctcatcccagcctctgagtct
ctgccccccagctatgtgacgtgctcttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035348
Entry
101035348         CDS       T04350                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X2
  KO
K05057  oncostatin M receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035348 (OSMR)
   04151 PI3K-Akt signaling pathway
    101035348 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035348 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035348 (OSMR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101035348 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101035348
NCBI-ProteinID: XP_003925960
UniProt: A0A2K6S9Y1
LinkDB
Position
Unknown
AA seq 977 aa
MAVFEVFPTVFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSAHQSLHLQWTVQNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSTVVD
ARFPEPNFWSNWSSWVEVNVQDSLGQDILFVFPKDKLVEEGANVTICYVSRNIQNNVSCY
WEGKQIYGEQLDPHVSVFHLSSVPFIRKTGADMYCEVSQGNVSKGIKGIVLFVSKVLEEP
KDFSCETQDFKTLHCTWDPGVDTALGWSKQPSQSYTLFESFSGENKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYPMNPFSVDFENVNATNAKMTWKVHSMKK
DFTYLCQIELYGEGKMMQYNVSIKVNGEYYLSELEPATEYMAQVRCADASHFWKWSEWSG
QNFTTLEAAPSEAPDVWRNVNSEPGSHIVTLFWKPLSKLHANGKILFYNVVVENLDKPSR
SELHSIPASAKSTKLTLNRHSYQVWVTANNSVGASPASIIVISADPENQEVEEERIAGTE
GGFSLSWKPQPGDVVGYVVDWCDHPKYTLCDLQWKNVGPNATSTVISTDTFRPGVRYNFR
IYGLSTKRIACLLAKKTGYSQELAPSDNPHVLVDKLTSHSFTLSWKYYSTESQPGFIQGY
HVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPKSFYEFFVTPFTSA
GEGPNATFTKVTTPDEHSTMLIYILLPMFFCVLLIMIVCYLKSQWIKETCYPDIPDPYKS
SILSLIKFKEKPHLTIMNVSDCIPDAIEVVSKPEGTKLQFRKSLTETELTRPNYVYLLPT
EKNYSGPGPFICFENLTYNQAASDSGSCGHVPVPVNNPPSQLGLMISPENVQKALEKNYM
NSLGEISAGETSLNYVSQLASPMSGDKDSLPTNPVEPPHCSEYKRQMAVPLCLVSPPPTE
NSSLSSITLLNPGEHYR
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggctgtatttgaagtctttccgacagtgttcttcttaacgttgctgtccttgaggact
taccagagtgaagtcttggctgaacgtttaccattgactcctgtatcacttaaagtttcc
accaattctgcacatcagagtttgcatttacaatggactgtccaaaaccttccatatcat
caggaattgaaaatggtatttcagatccagatcagtagaattgaaacatccaatgtcatc
tgggtggggaattatagcaccactgtgaagtggaaccaggttttgcattggagctgggaa
tccgaactccctttggaatgtgcaacacactttgtaagaataaagagtacggtggtcgat
gccaggttccctgagccaaatttctggagcaactggagttcatgggtggaagtcaatgta
caagattctcttggacaggatatattgttcgttttccctaaagataaactggtggaagaa
ggtgccaatgtcaccatttgctatgtttctagaaacattcaaaataatgtatcctgttat
tgggaagggaaacagatttatggagaacagcttgatccacatgtatctgtattccatttg
agtagtgtgcctttcattaggaaaacaggggcagatatgtattgtgaagtgagccaagga
aatgtctctaaaggcataaaaggcatcgttctctttgtctcaaaagtacttgaggagccc
aaggacttttcttgtgaaacccaggacttcaagactttgcactgtacttgggatcctggg
gtggacactgccttggggtggtctaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaataaactttgtacccacaaaaactggtgtaattggcaaataactcaa
gactcacaagaaacttataacttcacactcatagctgaaaattacctaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatccaatgaatccttttagtgtcgac
tttgaaaatgtaaatgccacaaatgccaaaatgacctggaaggtgcactccatgaagaag
gatttcacatatttgtgtcagattgaactctatggtgaaggaaaaatgatgcaatacaat
gtttccatcaaggtgaatggtgagtactacttaagtgaactggaacctgccacagagtat
atggcccaagtacgctgtgctgatgccagccacttctggaaatggagtgaatggagtggt
cagaacttcaccacacttgaagctgctccctcagaggcccctgatgtctggagaaatgtg
aactcagagccaggaagtcacattgtgaccttattctggaagcctttatcaaaattgcat
gccaatggaaaaatcctgttctataatgtagttgtagaaaatctagacaaaccgtccagg
tcagagctccattccattcctgcatcagccaaaagcacaaaactaactctcaaccggcat
tcctaccaagtctgggtcacagccaacaacagtgtgggcgcctctcctgcttctataata
gtcatctctgcagaccctgaaaaccaagaggttgaggaagaaagaattgcaggcacagag
ggtggattctctctgtcttggaaaccccaacctggagatgttgtaggctatgttgtggac
tggtgtgaccatcccaagtatacactctgtgatctccagtggaagaatgtaggtcccaat
gccacaagcacagtcattagcacagatacttttagaccaggagttcgatacaacttcaga
atttatgggttatctacaaaaagaattgcttgtttattagcgaagaaaacaggatactct
caggaacttgctccttcagacaaccctcatgtgctggtagataagttaacatcccattcc
ttcactctgagttggaaatattactctactgaatcgcaacctggttttatacaagggtac
catgtctatctgaaatccaaggcgagacagtgccatccacgatttgaaaaggcagttctt
tcagatggttcagaatgttgcaaatacaaaattgacaacccagaagaaaaggcattgatt
gtggacaacctaaagccgaaatccttctatgagtttttcgtcactccgttcactagtgct
ggtgagggccccaatgctacgttcacgaaggtcaccactccggatgaacactccacgatg
ctgatttatatcctactgcccatgtttttctgcgtcttgctcatcatgatcgtgtgctac
ttgaaaagtcaatggattaaggagacgtgttaccctgacatccctgacccttacaagagc
agcatcctgtcattaataaaattcaaggagaaacctcacctaacaataatgaatgtcagt
gactgtattccagatgctattgaagttgtaagcaagccagaagggacaaagttacagttt
aggaagtcactcacagaaaccgagttgactaggcctaactacgtttacctccttccaaca
gaaaagaattactctggccctggccccttcatctgttttgagaacttgacctataaccag
gcagcttctgactctggctcttgtggccatgttccagtacccgtgaacaaccccccaagt
cagctgggactaatgatctcacctgaaaatgtacaaaaggcactagaaaaaaactacatg
aactccctgggagaaatctcagctggagaaacaagtttaaattatgtgtcccagttggct
tcacccatgtctggagacaaggacagtctcccaacaaatccagtagagccaccacactgt
tcagagtataaaaggcaaatggcagtacccctgtgtcttgtctcgcctcccccgactgag
aatagcagcctctcctcaattactcttttaaatccaggcgaacactaccgctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035361
Entry
101035361         CDS       T04350                                 

Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X4
  KO
K05135  interleukin 10 receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035361
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035361
   04061 Viral protein interaction with cytokine and cytokine receptor
    101035361
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101035361
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101035361
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101035361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035361
   04090 CD molecules [BR:sbq04090]
    101035361
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101035361
CD molecules [BR:sbq04090]
 Proteins
  101035361
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 zf-MIZ
Other DBs
NCBI-GeneID: 101035361
NCBI-ProteinID: XP_003927704
UniProt: A0A2K6UCB1
LinkDB
Position
Unknown
AA seq 325 aa
MARSLRSWLGGCLLMSALGMVPPPENVRMNSVNFKNILQWESPAFTKGNLTFTAQFQSYR
TFQDTCVSTTSTECDFSSISKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGVQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCIQVQGFLPDRNKTGEWSEPVCEETTNDETVPSWMVAIILMASVFVVCLALLG
CFALLWYIYKKTKYAFCPGNSLPQHLKEFLGHPHHNTLLFFSLPFSDENDVFDKLSVITE
DSESGKQNPGDGHSLRTLPGQGSQS
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgcggagcctcaggagctggctgggcggctgcctgctgatgtcagcattgggaatg
gtgccacctcctgaaaatgtcagaatgaattctgttaatttcaagaacattctacagtgg
gagtcacctgcttttaccaaagggaacctgactttcacagctcagttccaaagttatagg
acattccaagatacatgcgtgagtactacctcgacggaatgtgatttctcaagtatttcc
aagtatggtgaccacaccttgagagtcagggctgaatttgcagatgagcattcggactgg
gtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggagtgcaagta
gaagtacttgctgattctttacatatgcgtttcttagcccccaaaattgagaatgagtat
gaaacttggactatgaagaatgtgtataactcatggacttataatgtgcaatattggaaa
aatggtactgatgaaaagtttcagattactcctcagtatgactttgaggtcctcagaaac
ctggagccgtggacaacttattgtattcaagttcaagggtttcttcctgataggaacaaa
actggggaatggagtgagcctgtctgtgaggaaacaaccaatgacgaaacggtcccctcc
tggatggtggccatcatcctcatggcctcggtctttgtggtctgcctggcactccttggc
tgcttcgccttgctgtggtacatttacaagaagacaaagtacgccttctgccctgggaat
tctcttccacagcacctgaaggagtttttgggccatcctcatcataacacgcttctgttt
ttctcccttccattctcggatgagaatgatgtttttgacaagctgagtgtcattacagaa
gactctgagagtggtaagcagaatcccggtgacggccacagcctcaggaccctgcctggc
cagggatcccagagctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035704
Entry
101035704         CDS       T04350                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1 isoform X1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035704 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035704 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101035704 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035704 (IL22RA1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101035704 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101035704
NCBI-ProteinID: XP_003934906
UniProt: A0A2K6UP33
LinkDB
Position
Unknown
AA seq 573 aa
MRTLLTILAVGSLAAHAPEDLSDLLQNVKFQSSNFENILTWESGPEGTPDTIYSIEYKTY
GERDWVAKKGCQRITRKSCNLTAETGNLTELYYARVIAVSAGGRTATKMTDRFSALQHTT
LKPPDVTCIPKVRSIQMIVHPTATPIRAGDGHRLTLEEIFQDLFYRLELQVNHTYQMRLE
GKQRQYEFFGLTPDTEFLGTITVFVTTWFKESAPYVCRVKTLPDRTWTYSFSGAFLFSMG
FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
YSQIRVSGPREPAGAPQRHSLPETTYLGQPDIILQPSNMPPPQIFSPLPYAPNTAPEVGP
PSYAPQVTPEAQPPFYTPQAISKVQPPSYAPQATPDSWPPSYGVCMEGSGKDSPTVTLSS
PKHLRPKGQLQKEAPAGSCLPGRLSLQEVTSLVMEESQEAKSLHQPLGVGTDRTSDPNVL
HSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLHPPSRPCSPSDQGPSPWDLLQSLVCPRD
EAKSPVPETADLEQPTELDALFRGLALTVQWEP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgaggacactgctgaccatcctggctgtgggatccctggccgctcatgctcctgaagac
ctctcagatctgctccagaacgtgaaattccagtccagcaactttgaaaacatcctgact
tgggagagcgggccagagggtaccccagacacgatctacagcatcgagtataagacatac
ggagagagggactgggtggcaaagaagggctgccagcggatcacccggaagtcctgcaac
ttgacggcggagacgggcaacctcacggagctctactatgccagggtcatcgctgtcagc
gcgggaggccgaacagccaccaagatgactgacaggttcagcgctctgcaacacactacc
ctcaaaccacctgatgtgacctgtatccccaaagtgagatcaatccagatgattgttcat
cctaccgccacgcccatccgtgcaggggatggccaccggctaaccctggaagaaatcttc
caagacctgttttaccgcttagagctccaagtcaaccacacctaccaaatgcgccttgaa
gggaagcagagacagtatgagttcttcggcctgacgcctgacacagagttccttggcacc
atcacagtctttgttaccacctggttcaaggagagtgccccctacgtgtgccgagtgaag
acgctcccagaccggacatggacctactccttctccggagccttcctgttctccatgggc
ttccttgtcgcagtgctctgctacctgagctacagatacgtcaccaagccacccgcacct
cccaactccctgaacgtccagcgagtcctgactttccagccgctgcgtttcatccaggag
cacgtcctgatccctgtcttcgacctcagtggccccagcagtctggcccagcctgtccag
tactcccagatcagggtgtctgggcccagggagcccgcgggagctccacagcggcacagc
ctgcctgagaccacctacttaggacagccggacatcatcctccagccctccaatatgcca
cctccccagatcttctccccactgccctatgccccaaacactgcccctgaggtcgggcct
ccgtcctatgcacctcaggtgaccccggaagctcaacccccattctataccccacaggcc
atctctaaggtccagcctccctcctatgcccctcaggccactccggacagctggcctccc
tcctatggggtatgcatggaaggttctggcaaagactcccccactgtgacactttctagt
cctaaacaccttaggcctaaaggtcagctgcagaaagaggcaccagctggaagctgcctg
ccaggccgcctttctctgcaagaagtgacctccctggttatggaggaatcccaagaagca
aaatcactgcaccagcccctgggggttggcacagacagaacatctgacccaaatgtgcta
cacagtggggaggaagggacaccacagtacctaaagggccagctccccctcctctcctca
gtccagatcgagggacaccccatgtccctccctttgcatcctccttcccgcccctgttcc
ccctctgaccagggtccaagtccctgggacctgctgcagtcccttgtgtgtcccagggat
gaagccaagagcccagtccctgagactgcagacctggagcagcccacagagctggatgct
cttttcagaggcctggccctcacggtacagtgggagccctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035973
Entry
101035973         CDS       T04350                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor
  KO
K05058  leukemia inhibitory factor receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035973 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035973 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101035973 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035973 (LIFR)
   04090 CD molecules [BR:sbq04090]
    101035973 (LIFR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101035973 (LIFR)
CD molecules [BR:sbq04090]
 Proteins
  101035973 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind MotB_plug TMEM154
Other DBs
NCBI-GeneID: 101035973
NCBI-ProteinID: XP_010334961
LinkDB
Position
Unknown
AA seq 1096 aa
MDIYVCLKRPSWMVASKRMRTASNFQWLLSIFILLYLMNQVNSQKKEGPHDLKCVTNNLQ
VWDCSWKAPSGTSRGTDYEVCIENRSHSCYQLEKTNIKIPALSHGDYEITINSLHDFGSS
TSKFTLNEKNVSLIPDTPEILNLSADFSASTLYLKWNDRGSVFPHHSNVFWEIKILRKES
MELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCRIDNLHFSGRKEWSDWSPV
KNISWTPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIKI
HNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETRDLKEIICSWNPGRLTGL
VGPRATSYSLYESFSGKYVRYKRDEAPTNESYQLFFQMLPNQQKYNFTLNAHNPLGRSES
TILVNITEKVYPHTPTSFKVKDINSTAVTLSWHLPGNFAKINLLCQIEIKKSKSVQEQRN
VTIKGVENSSYLVALDKLNPYTVYTFRIRCSTETFWKWSKWSNKKQHLTTEAIPSKGPDT
WREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHRAEIRLDKN
DYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIKW
CNSSRSEPCLMDWRKVPSNSTETVIESDQFQPGVRYNFFLYGCRNQGYQLLRTMIGYIEE
LAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGRS
DIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGMGPEKSMYVVTKENSVGLIIAIL
IPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMN
PCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNP
AADEAGGAAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSAVEDIAAEED
LDKTVGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSN
GGGWSFTNFFQNKPND
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggatatttacgtgtgtttgaaacgaccatcttggatggtggccagtaaaagaatgagg
actgcttcaaatttccagtggctcttatcaatatttattcttctatatctaatgaatcaa
gtaaatagccagaaaaaggagggtcctcatgatttgaagtgtgtaactaacaatttgcaa
gtgtgggactgttcttggaaagcaccctctggaacaagccgtggtactgattatgaagtt
tgcattgaaaacaggtcccattcttgttatcaattggagaaaacaaatattaaaattcca
gctctttcacatggtgattatgaaataacaataaattctcttcatgattttggaagttcc
acaagtaaattcacattaaatgaaaagaacgtttccttaattccagatactccagagatc
ttaaatttgtctgctgatttctcagcgtctacattatacctgaagtggaatgacaggggt
tcagttttcccacatcactcaaatgttttctgggaaattaaaattctacgtaaagaaagt
atggagcttgtaaaattagtgacccacaacacgactctgaatggcaaagatacacttcat
cactggagttgggcctcagatatgcccttggagtgtgccattcattttgtggaaattaga
tgccgcattgacaatcttcatttttctggtcgcaaagagtggagtgactggagtcctgtg
aagaacatttcttggacacctgattctcagactaaagtttttcctcaagacaaagtgata
cttgtaggctcagacataacattttgttgtgtgagtcaagaaaaagtgttatcagcactg
attggccatacaaactgccccttgatccatcttgatggggaaaatgttgcgatcaagatt
cataatatttctgtttctgcaagtagtggaacaaatgtggtttttacaaccgaagataac
atatttggaacggttatttttgcaggatatccaccagatactcctcaacaactgaattgt
gagacacgtgatttaaaagaaattatatgtagttggaatccaggaaggttgacaggattg
gtgggccctcgtgctacaagttactctttatatgaaagtttttcaggaaaatatgtgaga
tataaaagagatgaagcacctacaaatgaaagctatcaattattcttccaaatgcttcca
aatcaacaaaaatataattttaccttgaatgcccacaatcctctgggtcgatcagaatca
acaattttagttaatataaccgagaaagtttatccccatactcctacttcattcaaagtg
aaggatattaattcaacagccgttacactttcttggcatttaccaggcaactttgcaaag
attaatcttttatgtcaaattgaaattaagaaatctaaatcagtgcaagaacagcggaat
gtcacaatcaaaggagtagaaaattcaagttatcttgttgctctggacaagttaaatccc
tatacagtatatacttttcggattcgttgttctactgaaactttctggaaatggagcaaa
tggagcaataaaaaacaacatttaactacagaagccattccttcaaaggggcctgatact
tggagagagtggagttctgatggaaaaaatttaataatctactggaagcctttacccatt
aatgaagctaatggaaaaatactttcctacaatgtatcatgttcatcagatgaggaaaca
cagtccctttctgaaatccctgatcctcaacacagagcagagatacgacttgataagaat
gactacatcatcagtgtggtggctaaaaattctgtgggctcatcaccaccttccaaaata
gcgagtatggaaattccaaatgatgatctcaaaatagagcaagttgttgggatgggaaag
gggattctcctcacctggcattatgaccccaacatgacttgtgactacgtcattaagtgg
tgtaactcatctcggtcggaaccctgccttatggactggagaaaagttccctcaaacagc
actgaaactgtaatagaatctgatcagtttcaaccaggtgtaagatataattttttcctg
tatggatgcagaaatcaaggatatcaattattacggactatgattggatatatagaagaa
ttggctcccattgttgcaccaaattttactgttgaggatacctctgctgattcgatacta
gtaaaatgggaagacattcctgtggaagaactcagaggctttttaagaggatatttattt
tattttggaaaaggagaaagagacacatctaagatgagggttttagaatcaggtcgttct
gacataaaggttaagaatattactgacatatcccagaagacactgagaattgctgatctt
caaggtaaaacaagttaccacctggtcttacgagcctatacagatgggggaatgggccca
gagaagagtatgtacgtggtgacaaaggaaaattctgtgggattaattattgccattctc
atcccagtggcagtagctgtcattgttggagtggtgacaagtatcctttgctatcggaaa
cgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaagca
ttacagtttcaaaagagtgtctgtgagggaagcagtgctcttaaaacattggaaatgaat
ccttgtaccccaaataatgttgaggttttggaaactcgatcagcatttcctaaaatagaa
gatacagaaataatatccccagtagcggagcgtcctgaagatcgctctgatgcagagcct
gaaaaccatgtggttgtgtcctactgtccacccatcattgaggaagaaataccaaaccca
gccgcagatgaagctggaggggctgcacaggtcatttacattgatgttcagtcaatgtat
cagcctcaagcaaaaccagaagaagaacaagaaaacgacccagtaggaggggcaggctat
aagccacagatgcaccttcccattaattctgctgtggaagatatagctgcagaggaggac
ttagataaaactgtgggttatagacctcaggccaatgtaaatacgtggaatttagtgtct
ccagactctcctagatccatagacagcaatagtgagattgtctcatttggaagtccatgc
tccattaattcccgacaatttttgattcctcctaaagatgaagactctcctaaatctaat
ggaggagggtggtcctttacaaacttttttcagaacaaaccaaacgattaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036589
Entry
101036589         CDS       T04350                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101036589 (IL2RA)
   04151 PI3K-Akt signaling pathway
    101036589 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101036589 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101036589 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101036589 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101036589 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    101036589 (IL2RA)
   04659 Th17 cell differentiation
    101036589 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036589 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036589 (IL2RA)
   05162 Measles
    101036589 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101036589 (IL2RA)
   04090 CD molecules [BR:sbq04090]
    101036589 (IL2RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101036589 (IL2RA)
CD molecules [BR:sbq04090]
 Proteins
  101036589 (IL2RA)
SSDB
Motif
Pfam: Sushi Stevor
Other DBs
NCBI-GeneID: 101036589
NCBI-ProteinID: XP_003939090
UniProt: A0A2K6TE08
LinkDB
Position
Unknown
AA seq 272 aa
MDSHLLMWGLLTFIMVPGCLAELCDDDPPKITYATFKALAYKEGTMLNCECNRGFRRIKS
GSPYMLCTGNSSHASWENQCQCISSSPRNTTKQVTPQPEEQKERKTTEVHNPRQQVDQSR
LPGHCREPPHWENEGTERIYHFVVGQTVHYQCIQGYRALHRGPAKSICTMTHGKTRWTQP
QLVCTKQTEPSQFPGEEEPQASPDSLLESETSCLITTTDFQIQTEVAATMETFILTTGYQ
LAVAGCVFLLISVLLLSGLTWRQRRRKSRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggattcacacctgctgatgtggggactgctcacgttcatcatggtgcccggctgcctg
gcagagctctgtgatgatgacccgccgaagatcacatatgccacgttcaaagccttggcc
tacaaggaagggaccatgttgaactgtgaatgcaacagagggttccgcagaataaaaagc
gggtcaccctacatgctctgtacaggaaactctagccatgcgtcctgggagaaccagtgt
cagtgcataagctcttcccctaggaacacaacaaagcaagtgacacctcaacctgaagag
cagaaagagagaaaaaccacagaagtgcacaatccaaggcagcaggtggaccaatcgcgc
cttccaggtcactgcagggagcctccgcactgggaaaatgaaggcacagaaagaatttat
cattttgtggtggggcagacggttcactaccagtgcatccagggatacagggctctacac
agaggtcctgccaagagcatctgcacaatgacccatggaaagacaaggtggacccagccc
cagctcgtgtgcacaaagcaaacagagcccagccagtttccaggtgaagaggagcctcag
gcaagccccgacagccttcttgagagtgagacctcctgcctcatcacaacgacagatttt
cagatacagacagaagtggctgcgaccatggagacgttcatacttacaacggggtaccag
ctagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcggcagagacggaggaagagtagaagaacaatctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036913
Entry
101036913         CDS       T04350                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101036913 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101036913 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101036913 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036913 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036913 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101036913 (IL15RA)
   04090 CD molecules [BR:sbq04090]
    101036913 (IL15RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101036913 (IL15RA)
CD molecules [BR:sbq04090]
 Proteins
  101036913 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101036913
NCBI-ProteinID: XP_010348030
UniProt: A0A2K6SAV0
LinkDB
Position
Unknown
AA seq 336 aa
MKHGGSSPAFPRSHSLLLIQAFSWEAKLQQEFGQGPRGRPGKSKLRSCRRPAQGEVQWIR
AQRGLKRVCSPTASPTLSAVWTPNRAHTGGPGARGARRTGITCPDPVSVEHADIQVKSYS
LHSRERYICNSGFKRKAGTSSLTECVLNKATNVAYWTTPSLKCIRDPALARQRPAPPSTV
TTAGVTLQPKSFSPSGKEPAASSPSSDTAVATTAALIPGSRLMPSKSPSMGTTGIGSHES
SHSPSQMTARTWELTASASHQSPDGYPQGNSSTMVAISTSTVLLCGLSAVSLLVYYIKSR
QTPRPHSIEMEAMEALPVTGGTSDRDEDSENRTHNL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaagcatggtggctcctctcccgcttttcctcgctcccactccctccttctaatacag
gcattttcctgggaagcaaagctgcagcaggaattcggccaaggccccagagggagacct
ggaaagtcgaagttgcgcagctgtaggcgaccagcgcagggcgaggtccagtggatccga
gcacagaggggactgaaaagagtctgctctccgacggcttcgcccactctctcggcagta
tggacaccgaaccgagcgcacactgggggtcctggagcacgaggcgcgcggagaaccggc
atcacatgccctgacccggtgtccgtggaacacgcagacatccaggtcaagagctacagc
ttgcactccagggagcggtacatttgtaactctggtttcaagcgtaaagccggcacatcc
agcctgaccgagtgcgtgttgaacaaggccaccaacgtcgcctactggacaacccccagt
ctcaaatgcatccgagaccctgccctggctcggcaaaggccagcaccaccctccacagta
acaacggcaggggtgaccctgcagccaaagagcttctccccttctggaaaagagcctgca
gcttcatctcccagctcagacaccgcagtggccacaacagcagctcttatcccgggctcc
cggctgatgccttcgaaatcaccttccatgggaaccacagggataggcagtcatgagtcc
tcccacagcccctctcagatgacagccaggacctgggaactcacggcgtctgcttcccac
cagtcgccagatgggtatccacagggcaacagcagcaccatggtggccatttccacgtcc
accgtcctgctgtgcgggctgagtgctgtctctctcctggtatactacatcaagtcaagg
caaactccccggccgcacagcattgaaatggaagccatggaagctctgccagtgactgga
ggcaccagcgacagagacgaagactcggaaaaccgcactcacaacctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037958
Entry
101037958         CDS       T04350                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04066  HIF-1 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04659  Th17 cell differentiation
sbq04932  Non-alcoholic fatty liver disease
sbq05163  Human cytomegalovirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101037958 (IL6R)
   04066 HIF-1 signaling pathway
    101037958 (IL6R)
   04151 PI3K-Akt signaling pathway
    101037958 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101037958 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101037958 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101037958 (IL6R)
   04659 Th17 cell differentiation
    101037958 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101037958 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101037958 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101037958 (IL6R)
   05163 Human cytomegalovirus infection
    101037958 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101037958 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101037958 (IL6R)
   04090 CD molecules [BR:sbq04090]
    101037958 (IL6R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101037958 (IL6R)
CD molecules [BR:sbq04090]
 Proteins
  101037958 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3
Other DBs
NCBI-GeneID: 101037958
NCBI-ProteinID: XP_003938071
UniProt: A0A2K6SWT3
LinkDB
Position
Unknown
AA seq 495 aa
MGEGKAIGVSGTSPNSPGCTVTTSQLSYPSSGALVVRRKPLLQWLWAYRVSPPSPEVARG
VLTSQPGDSVTLTCPGGELEDNATVDWVLGQPAAGAHPGRWAGVGRRLLLRSVQLQDSGN
YSCYRAGRPAGTVHLLVEVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKF
DNGPAKDFQEPCGYSQESQKFSCQLAVPEGDSSFYIVSLCVANSVGSKFSKVQTFQGCGI
LQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVRDL
QHHCVIHDAWSGLRHVVQLRAQEEFGQGKWSEWSPEATGTPWTESRSPPAEKEVFTPTQA
PTTNKDNNNTLPRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAVGLRFKKTWK
RRAQKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHSRPDARDP
RSPYDISNRDYFFPG
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgggggaaggtaaggccataggggtctcaggaacttcgccaaactcgcctggctgcacg
gtgacaaccagccagctttcttacccgagctccggggctctggtggtcagaaggaagccg
cttcttcagtggctgtgggcttaccgagtgtctcctccctccccagaggtggcgagaggc
gtgctgaccagccagccgggagacagcgtgaccctgacctgccccgggggagagctggaa
gacaatgccactgtggactgggtgctcgggcagccggctgcaggtgcccacccgggcaga
tgggctggcgtgggaaggaggctgctgctgaggtccgtgcagctccaggactctggaaac
tattcctgctaccgggccggccgcccagctgggactgtgcacttgctggtggaggtccct
cccgaggagccccagctctcctgcttccggaagagccccctcagcaacgttgtttgtgag
tggggtcctcggagcaccccgtccccgaccaccaaggctgtgctgttggtgaggaagttt
gataacggtccggccaaagacttccaggagccgtgcggttattcccaggagtcccagaag
ttctcctgccagttggccgtcccggagggagacagctctttctatatagtgtccctgtgc
gtcgccaatagtgtcgggagcaagttcagcaaagttcaaacctttcagggctgtggaatc
ttgcagcccgatcctcctgccaacatcacagtcactgctgtggccagaaacccccgctgg
cttagtgtcacctggcaagacccccactcctggaactcatctttctacagactgcggttt
gagctcagatatcgggctgaacgatcaaagacattcacaacgtggatggtcagggacctc
caacatcactgtgtcatccacgacgcctggagcggcctgaggcacgtggtgcagcttcgc
gcccaggaggagttcgggcaaggcaagtggagcgagtggagcccagaggccacgggcaca
ccttggacagaatccaggagtcctccagctgagaaggaggtgttcacccccacgcaggcg
cctactactaataaagacaacaataatactctccccagagattctgcaaatgcgacaagc
ctcccagtgcaagattcttcttccgtaccgctgcccacattcctggtggctggagggagc
ctggcctttggaacgctcctctgcattgctgttggcctcaggttcaagaagacgtggaag
cggcgggctcagaaggaaggcaagaccagcatgcacccgccgtactctctggggcagctg
gttccggagaggccccgacccaccccagtgcttgttcctctcatctccccgccggtgtcc
cccagcagcctggggtctgacaacacctcgagccacagccgaccagatgccagggaccca
cggagcccttatgacatcagcaacagagactacttcttccccggatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038323
Entry
101038323         CDS       T04350                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038323 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038323 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101038323 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbq00537]
    101038323 (CNTFR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101038323 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbq00537]
 Receptors
  101038323 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 101038323
NCBI-ProteinID: XP_003943885
UniProt: A0A2K6UDL2
LinkDB
Position
Unknown
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYTQRHSPQEAPHVQYERLGSDVTLSCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLHHQVLLHVGLPPREPVLSCRSNT
YPKGFYCNWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQASETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPVTLAL
AAAAATASNLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgctgctgccgctgcagttgtg
tacacccagagacacagtccacaggaagcaccccacgtgcagtatgagcgcctgggctct
gatgtgacgctgtcatgtgggacagcaaactgggatgcagcggtgacatggcgggtcaat
gggacagacctggcccctgacctgctcaacggctctcagctggtgctccgtggcctggaa
ctgggccacagtggcctctacgcctgcttccaccgtgactcctggcacctgcaccaccaa
gtcctgctgcatgtgggcttgccgccacgggagcccgtgctcagctgccgctccaacact
taccccaagggcttctactgcaactggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcacggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgtcacattcgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgctctgggccacaatgccacagctatcacctttgacgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtacccagcaaccctcgc
cggctggaggtgacgtggcagaccccgtcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtca
gacggcacagcacacaccatcacagatgcctatgccgggaaggagtacattatccaggtg
gcagccaaggacaatgagatcgggacatggagtgactggagcgtggccgcccacgctaca
ccctggactgaggaaccacgacacctcaccaccgaggcccaggcgtcggagaccacgacc
agcaccaccagctccctggcacccccgcccaccacgaagatctgtgaccctggggagctg
ggcagcggcgggggaccctcagcacccttcttggtcagcgtccctgtcactctggccctg
gctgccgctgctgccactgccagcaatctcttgatctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038590
Entry
101038590         CDS       T04350                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038590 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038590 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101038590 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101038590 (IL9R)
   04090 CD molecules [BR:sbq04090]
    101038590 (IL9R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101038590 (IL9R)
CD molecules [BR:sbq04090]
 Proteins
  101038590 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 101038590
NCBI-ProteinID: XP_010349654
LinkDB
Position
Unknown
AA seq 493 aa
MGTWLLTYICVCTCVCSGVSVPGEGRGPRAGTFTCLTNNILRIDCHWSAPELAQGSSAWL
LFTSNQAPGGTHKCMLQGSECTLLLPPEAVILPSDNFTITFHHCVFGREQVSLVDPRYLP
RRHVKLDPPSDLQSNVSSGHCMLTWIISPALEPMTTLLSYELAFKKQEEAWERAQHRDHI
VGVTWLILEAFELDPGFIHEARLRVQMAMMEDDVAEEERYAGQWSEWSQPVCFQAPQRQG
PLIPPLGRPDNILIAVSVFLLLTGLIYLLFKLSPRVKRTFYRNVPSPAAFFQPLYSMHNG
NFQTWMGVHRTGVLLNQDSAGTSRGALEPSVQEAIALLTCGPLYPWKSVFLEEEQENTGT
SVLGNLTSEDVLPAGCTEWRAQPLAYLPQEDWTPMSPTRPAPPNSEGGSSSSDYCGVLDC
YRGCHPSTLPRNMQSSGPIPTMARGLSCEHQGLETQQGGAWMLAGHCQRPGLHEDLQGML
LPPVFNKPRSWTF
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgggcacctggctcctaacctacatctgcgtctgcacctgtgtctgctcaggagtctcc
gtcccaggggaaggacgagggccaagggctggaaccttcacctgcctcaccaacaacatc
ctcaggatcgattgccactggtctgccccagagctggcccagggctccagcgcctggctc
ctcttcaccagcaaccaggcacctggcggcacacataagtgcatgttgcagggcagtgag
tgcactctactgctgccacccgaggcggtgatcctgccatctgacaatttcaccatcact
ttccaccactgcgtgtttgggagggagcaggtcagcctggtggacccgcggtacctgccc
cggagacacgttaagctggatccaccctctgacttgcagagcaatgtcagctctggccac
tgcatgctgacctggatcatcagtcctgccttggagccaatgaccacacttctcagctat
gagctggccttcaagaagcaggaagaggcctgggagcgggcccagcacagggatcacatt
gttggggtgacctggcttatacttgaagcctttgagctggaccctggctttattcatgag
gccaggctacgtgtccagatggccatgatggaggatgatgtggcggaggaggaacgttat
gcaggccagtggagcgagtggagccagcctgtgtgcttccaggctccccagagacaaggc
cctctcatcccacccttggggcgcccagacaacatccttattgctgtgtctgtctttctc
ctgctgactggcctgatctaccttctgttcaagctgtcacccagggtgaagagaaccttc
taccggaacgtgccctctccagcggcattcttccagcccctctacagtatgcacaatggg
aacttccagacttggatgggggtccacaggaccggcgtgctgctgaaccaagactctgct
ggcacctcacgaggagccttggaacccagtgtccaggaggccattgcactgctcacctgt
ggcccactgtatccttggaaatctgtgttcctggaggaggagcaggagaacaccgggacc
agcgtcctggggaacctgacctcagaggatgtgctgccagcagggtgtacggagtggagg
gcacagccgcttgcctatctgccacaggaggactggacccccatgtcccccaccaggcca
gctcccccaaactcagagggcggcagcagcagcagtgactactgtggtgtcttggactgc
tacaggggatgccacccctcaaccctccctagaaacatgcagagctctgggcccatccca
accatggcccgtggcctttcctgtgagcatcagggcctggagacccagcaaggaggtgcc
tggatgctggctggtcactgccagaggcccgggctgcatgaggacctccagggcatgttg
ctccctcctgtcttcaacaagcctcggtcctggacattctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038788
Entry
101038788         CDS       T04350                                 

Gene name
CSF2RA
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038788 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038788 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101038788 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038788 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101038788 (CSF2RA)
   04090 CD molecules [BR:sbq04090]
    101038788 (CSF2RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101038788 (CSF2RA)
CD molecules [BR:sbq04090]
 Proteins
  101038788 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 101038788
NCBI-ProteinID: XP_010336247
LinkDB
Position
Unknown
AA seq 413 aa
MKVPLVPALLLCAWLRAAVLRTAGHSGRTTVAPASGLNITFDSRTMILSWSCKDNTSLSR
CILIHKKDGPIEYRLRNKQCFCTFREVTLHGGVTFEVHVQTSQGEFQEKMPYPNSGREGS
AARNFSCFIYNADFMNCSWARGPTAPCDVQYSLSIRDSKGRREIPCPYYTQDAGTHVGCH
LNNLSGLTSRNYFLVTGTSREVGIQFFDSLLDVNKIERFDPPGNITVTCNKTQCVVRWRQ
PRTRQRRHFLEFRYQLHVCRQNSQPDTENTLITVQGGLDNRYNLPSSEPRAKRTVKMRTA
DFRILTWGPWSRPTEFGSDDGQTSSVHIYVLLVLGTLVCALFLGFLFKRCVQMQRLFPPV
PKIKDKLNDENQVEDQLGLQRHHGVWLESVSSSRTFHLGSGQGVVRSWSAFSL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaggtccccctggtgccagcgcttctcctctgtgcgtggctgcgcgctgccgtcctg
cggaccgcggggcactcgggtcgaacaactgtggccccagcctccggcctcaacatcacg
ttcgactccaggacgatgatattaagctggagctgtaaagacaacaccagcctcagcagg
tgcatcttaatacacaaaaaggacggacccatcgaatacaggctcaggaacaaacaatgt
ttctgcacgtttcgtgaggtcactctccacggaggagtcactttcgaggtgcacgtgcag
accagccaaggagaatttcaagaaaaaatgccttatcccaattccggtagggagggttcc
gctgcccggaatttctcctgcttcatctacaacgcggatttcatgaactgtagctgggca
cggggtccgaccgccccctgcgatgtccagtattctttgtccatacgagactccaaggga
aggcgggagattccgtgtccttattacacgcaggacgcgggaacccacgtggggtgtcac
ctgaacaacctgagcggattaacctcccgcaattacttcctggttaccgggaccagccga
gaagtcgggatccagttcttcgattcacttttggacgtcaacaaaatagaacgcttcgac
ccgcccggcaacatcacggtgacctgcaacaagacgcagtgtgtggtgcggtggagacag
cccaggacgcgccagcgccggcacttcctggagttccgctaccagctgcacgtgtgcaga
cagaactctcaacctgacactgaaaacacactgattaccgttcagggtggcttggataat
aggtataaccttccaagctccgagccccgagcgaagcgtacggtgaagatgagaaccgct
gacttccgcattctgacctggggtccctggagcaggcccactgaatttgggtctgatgac
ggacagaccagctccgtgcacatctatgtgctcttggtcctcgggaccctggtatgcgcc
ctgttcctcggcttcctgtttaaaaggtgtgtccagatgcaacgactcttccccccagtt
ccaaaaatcaaagacaaactcaacgatgagaatcaggtggaggaccagctgggacttcag
cgtcaccacggggtgtggctggaatctgtatccagctcccggaccttccacctgggttcg
ggtcagggtgtcgtcaggtcgtggtcagcgttttctctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039092
Entry
101039092         CDS       T04350                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101039092 (IL3RA)
   04151 PI3K-Akt signaling pathway
    101039092 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101039092 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101039092 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101039092 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039092 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101039092 (IL3RA)
   04090 CD molecules [BR:sbq04090]
    101039092 (IL3RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101039092 (IL3RA)
CD molecules [BR:sbq04090]
 Proteins
  101039092 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N Tissue_fac IL4Ra_N
Other DBs
NCBI-GeneID: 101039092
NCBI-ProteinID: XP_010334275
LinkDB
Position
Unknown
AA seq 474 aa
MGLGSESQGWGCAGGYKTAAGGMEASLSLWRSFLQRKQENHGNVQSWGHRPRMGTPRAFC
TGARKAASPTRDFRLHLRHLGPERAAFPMVLLWLTLLLMPGPGLLQTNQMTKPAIRNLRV
EATTQTLTWDVDGNVTGIQCQKGPDYGIHAMSDRYCQFEAISFCEVTNYSVTAASPPFSA
WILFPEAGGNPQAAAQNLTCWVHGVDLMTCSWAVGPEAPGDVQYHLSVSHRDGQEQHLCV
HYNRNQRGTHIGCVFSDISGISRGSPSAFILVTGSSEAFRVPCVDQLVVFSVIEILTPPN
LTAKCNKTHSFMEWKMRSHFNRDFHYELQIQKSKQPVITEQVKGITSFQLLNPGTYTVRI
RAQEIYEQFWSAWSSHQRFECDQEEDPHTRAWRTSLLIALGTLLAVLCAVLLCKRYLVME
RLFPRLPHMKDPMGNGFRNDKLVRCVSRQGRELGAWRALWEAEAGGQLEARQWR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggccttgggtctgagtcccaggggtggggctgcgcgggaggttataaaacggctgca
ggggggatggaagcttcgctttctctttggagaagcttcctgcagcgcaaacaggaaaat
cacgggaacgtgcagagttggggacacaggcctcggatggggacacctcgggccttctgc
accggagctaggaaggctgcttctcccacacgggacttccgtctgcatttaaggcacctc
ggtcctgagagagctgcgttccccatggtcctcctgtggctcacgctgctgctgatgccc
gggcccggcctcctgcaaaccaaccagatgacaaagcccgccatcaggaacttaagggtg
gaagccacaactcagacgttgacatgggatgtggatgggaatgtgaccggtattcagtgc
cagaaaggtccagactatggaatacatgcgatgagtgatcgctactgccagttcgaagcc
atttccttctgtgaggtgaccaactacagcgtcacggccgccagcccgcccttctcggcc
tggatcctcttcccggaggccggtgggaatccgcaggcagccgcgcagaacctgacgtgc
tgggtccacggggtggacctgatgacctgcagctgggccgtgggtcccgaggcccccggg
gacgtccagtaccacctgtcggtcagccatcgcgatggccaggagcagcacctctgtgtc
cactacaacaggaatcagcgagggactcacattggctgcgtgttcagtgacatctctggc
atctccagagggtcgccatcagcctttatcctagtgacgggctccagcgaggccttccgc
gtcccctgcgtagaccagcttgtcgtgttttcggtgattgagatactaactccgcccaac
ttgaccgccaagtgtaataaaacacattctttcatggagtggaaaatgagaagtcatttc
aatcgcgactttcactatgagcttcagatacaaaagagcaagcagcctgtaatcacagaa
caggtcaaaggcataacctccttccagctgctcaatcccggaacgtacacagtgagaata
agagcccaggaaatctatgagcaattctggagcgcctggagcagccaccagcgctttgag
tgtgatcaggaggaggacccgcacacccgagcctggcggacgtcactgctcatcgcgctg
gggacgttgctggccgtgctctgtgctgtcctgctctgcaaaaggtacctcgtgatggag
agactgtttccccgtctccctcacatgaaagaccccatggggaacggcttccgaaacgac
aagctggtacgttgtgtttcccgccaagggagggagctgggggcgtggcgggcactttgg
gaggctgaggcaggtggacagctggaggccaggcagtggaga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040156
Entry
101040156         CDS       T04350                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040156 (PDGFRA)
   04014 Ras signaling pathway
    101040156 (PDGFRA)
   04015 Rap1 signaling pathway
    101040156 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101040156 (PDGFRA)
   04020 Calcium signaling pathway
    101040156 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101040156 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101040156 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101040156 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101040156 (PDGFRA)
   04540 Gap junction
    101040156 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101040156 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040156 (PDGFRA)
   05206 MicroRNAs in cancer
    101040156 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101040156 (PDGFRA)
   05231 Choline metabolism in cancer
    101040156 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101040156 (PDGFRA)
   05218 Melanoma
    101040156 (PDGFRA)
   05215 Prostate cancer
    101040156 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101040156 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101040156 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101040156 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sbq04090]
    101040156 (PDGFRA)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101040156 (PDGFRA)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101040156 (PDGFRA)
CD molecules [BR:sbq04090]
 Proteins
  101040156 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 LAT Kinase-like
Other DBs
NCBI-GeneID: 101040156
NCBI-ProteinID: XP_010342458
LinkDB
Position
Unknown
AA seq 1102 aa
MALFGLHFWFSRAMGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSL
RCFGESEVSWQYPMSEEENSSVEIRNEENNSGLFVTVLEVSNASAAHTGLYTCYYNHTQT
EENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGV
VPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSKLDLEMEALKTVYKS
GETIIVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGD
YECAARQATREVKEMKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKNFVVEVQAYPTPRI
SWLKNNLTLIENLTEITTDVEKIQETRYRSQLKLIRAKEEDSGHYTIVVQNEDDVKSYTF
ELLTQVPSSILDLVDDHHGSTGGQTVRCMAEGTPLPDIEWMICKDIKKCNNETSWTILAN
NVSNIITEVHPRGRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLS
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYVGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggcactatttggacttcacttctggttttccagagctatggggacttcccatccggcg
ttcctggtcttaggctgtcttcttacagggctgagcctaatcctctgccagctttcatta
ccctctatccttccaaatgaaaatgaaaaggttgtgcagctgaattcatccttttctctg
agatgctttggggagagtgaagtgagctggcagtaccccatgtctgaagaagagaactcc
agtgtggaaatcagaaatgaggaaaacaacagtggcctttttgtgacggtcttggaagtg
agcaatgcctcggcagcccacacagggctgtacacttgctattacaaccacactcagaca
gaagagaatgagcttgaaggcaggcacatttacatctatgtgccagacccagatgttgcc
tttgtacctctaggaatgacggattatttagtcattgtggaggacgatgattctgccatc
ataccttgtcgcaccactgatcctgagactcctgtaaccttacacaacagcgagggggtg
gtacctgcctcctacgacagcagacagggctttaatgggaccttcactgtcgggccctat
atctgtgaggccaccgtcaaaggaaaaaagttccagaccatcccttttaatgtttatgct
ttaaaagcaacatcaaagctggatctagaaatggaagctcttaaaactgtgtataagtca
ggggaaacgattatagtcacctgtgctgtttttaacaatgaggtggttgaccttcagtgg
acttaccctggagaagtgaaaggcaaaggcatcacaatgcttgaagaaatcaaagtccca
tccatcaaattggtgtacactttgacggtccccgaggccacggtgaaagacagtggagat
tacgaatgtgctgcccgccaggctaccagggaggtcaaagaaatgaagaaagtcactatt
tctgtccatgagaaaggcttcattgagatcaaacccaacttcagccagttggaagctgtc
aacctgcatgaagtcaaaaattttgtcgtagaggtacaggcctacccaactcccaggata
tcctggctgaaaaacaacctgactctgatcgaaaatctcaccgagatcaccactgatgtg
gaaaagattcaggaaacaaggtatcgaagccaattaaagctgatccgtgctaaggaagaa
gacagtggccattatactattgtagttcaaaatgaagatgatgtgaagagctatactttt
gaactgttaactcaagttccttcatccattctggacttggttgatgatcaccatggctca
actgggggtcagacagtgaggtgcatggctgaaggcacaccgcttcctgatattgagtgg
atgatttgcaaggatattaagaaatgtaataatgaaacttcgtggacgattttggccaac
aatgtctcaaacatcatcacggaggtccatccccgaggcaggagtaccgtggagggccgt
gtgactttcgccaaagtggaggagaccattgcggtgcgatgcctggctaagaatctcctt
ggtgctgagaaccgagagctgaagctcgtagctcccaccctgcgttctgaactcacggtg
gctgctgcggtcctggtgctgttggtgattgtgatcatctcactcattgttctggtcgtc
atttggaaacagaaaccgaggtatgaaattcgctggagggtcattgaatcaatcagccct
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcaagatgggag
tttccaagagatggactagtgcttggtcgggtgttggggtctggagcgtttgggaaggtg
gttgaaggaacagcctatggactgagccgatcccagcctgtcatgaaggttgccgtgaag
atgttaaagcccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgactcacctggggccacatttgaacattgtaaacttgctgggagcctgcaccaagtca
ggccccatctacatcatcacagagtactgcttctatggagatttggtaaactatttgcat
aagaatcgggatagcttcctgagccaccacccagagaagccaaagaaagagctggatatc
tttggattgaaccctgctgatgaaagcacacggagctatgttattttgtcttttgaaaac
aatggtgactacatggatatgaagcaagctgatactacacagtatgtccccatgctggaa
aggaaagaagtttctaaatattccgacatccagagatcactctatgatcgtccagcctca
tataagaagaaatccatgttagactcagaagtcaaaaacctcctttcagatgataactca
gaaggccttactctgttggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcctcaaaaaattgtgtccaccgggatctggctgctcgtaatgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgactcg
aactacgtgtcaaaaggcagcacctttctgcctgtgaagtggatggctcctgagagcatc
tttgacaacctctacaccacactgagtgacgtctggtcttacggcattctgctctgggag
atcttttcccttggtggcaccccttaccctggcatgatggtggattctactttctacaat
aagatcaagagtggataccggatggccaagcctgaccacgctaccagtgaagtctatgag
atcatggtgaaatgctggaacagtgagccggaaaagagaccctccttttaccacctgagt
gagattgtagagaatctgctgcctggacaatataaaaagagttacgaaaaaattcacctg
gacttcctgaagagtgaccatcctgccgtggcacgcatgcgtgtggactcagacaacgcg
tacgttggtgtcacctacaaaaacgaggaagacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagcgctgacagtggctacatcattcctctgcctgacatcgaccct
gtccccgaggaggaggacctgggcaagaggaacagacacagctcgcagacctctgaagag
agtgccattgagacgggttccagcagttccaccttcatcaagagagaggacgagaccatt
gaagacatcgacatgatggacgacatcggcatagactcttcagacctggtggaagacagc
ttcctgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040158
Entry
101040158         CDS       T04350                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040158 (PDGFRB)
   04014 Ras signaling pathway
    101040158 (PDGFRB)
   04015 Rap1 signaling pathway
    101040158 (PDGFRB)
   04630 JAK-STAT signaling pathway
    101040158 (PDGFRB)
   04020 Calcium signaling pathway
    101040158 (PDGFRB)
   04072 Phospholipase D signaling pathway
    101040158 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    101040158 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101040158 (PDGFRB)
   04540 Gap junction
    101040158 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101040158 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040158 (PDGFRB)
   05206 MicroRNAs in cancer
    101040158 (PDGFRB)
   05230 Central carbon metabolism in cancer
    101040158 (PDGFRB)
   05231 Choline metabolism in cancer
    101040158 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    101040158 (PDGFRB)
   05218 Melanoma
    101040158 (PDGFRB)
   05215 Prostate cancer
    101040158 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101040158 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101040158 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101040158 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sbq04090]
    101040158 (PDGFRB)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101040158 (PDGFRB)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101040158 (PDGFRB)
CD molecules [BR:sbq04090]
 Proteins
  101040158 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 101040158
NCBI-ProteinID: XP_003934058
UniProt: A0A2K6TAR3
LinkDB
Position
Unknown
AA seq 1108 aa
MQLPGTMAALAFKGQLLLLPLLLLLEPQVSQSLVITPPGPELVLNVSSTFILTCSGSAPV
VWERMSQEPPQEMAKAQDGSFLSVLTLSNLTGLDTGEYFCTYNDSRGLELDERKRLYIFV
PDPTVAFLPNDAEELFIFLTEITETTIPCRVTDPQLVVTLHEKKGDIALPVLYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRQESGRLVEPVTDFLLDMPYHIRSILHIPSAELDDSGTYICNVTESVNDH
QDEKAINITVVESGYVRLLGELDALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEAQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPDIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPMSVRCTLRNAVGQDIQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDFLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCQATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEESEPQPQLELQV
EPDPEPELEQPPDSGCPAPRPEAEDSFL
NT seq 3327 nt   +upstreamnt  +downstreamnt
atgcagcttccgggtacgatggcagctctggccttcaaaggccagctgctgttgctgccc
ctgctgttactgctggaaccgcaggtctctcagagcctagtcatcacaccccccgggcca
gagcttgtcctcaatgtctctagcaccttcattctgacctgctcgggttcagctccggtg
gtatgggaacggatgtcccaggagcccccgcaggaaatggccaaggcccaggacggcagc
ttcctcagtgtgctgacattgagcaacctcactgggctagacacgggggaatacttctgc
acctacaatgactcccgtggcctggagctggatgagcggaagcggctctacatctttgtg
ccagatcccaccgtggccttcctccctaatgacgccgaggaactattcatctttctcacg
gaaataactgagaccacaattccatgccgagtgacagacccgcagctggtggtgacgctg
catgagaagaaaggggatattgcactgcctgtcctctacgatcaccaacgtggcttttct
ggtatcttcgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgacgcctactatgtctacagactccaggtgtcatctatcaacgtctctgtgaacgct
gtgcagactgtggtccgccagggcgagaacatcaccctcatgtgcatcgtgatcgggaat
gaggtggtcaactttgagtggatgtacccccgccaagagagcgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttggacgactcgggaacctacatctgcaatgtgacagagagtgtgaatgaccat
caggatgaaaaggccatcaacatcactgtggttgagagtggctacgtgcggctcctggga
gagctggacgctctacagtttgccgagctgcaccgaagccggacgctgcaggtagtgttc
gaggcctatccgccgcccaccgtcctgtggttcaaagacaaccgcaccctgggtgactcc
agcgctggcgagatcgccctgtccacccgcaacgtgtcggagacccggtacgtgtcagag
ctgaccttggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggatgctgaggcccagctctccttccagctgcagatcaatgttcctgtccgcgtgctg
gagctaagcgagagccaccctgacagtggggaacagactgtccgctgtcgtggccggggc
atgccccagccggacatcatctggtctgcctgcagagacctcaaaaggtgtccacgggag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcactctgcgtctgcagcacgtg
gatcggccaatgtcggtgcgctgcacgctgcgcaatgctgtgggccaggacatacaggag
gtcatcgtggtgccacactccctgcccttcaaggtggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaaacca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgcctcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgctgaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagccacctcgggcct
cacctgaacgtggtcaacctgctgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactttctgcaccgcaacaagcataccttt
ctgcagcaccactccgacaagcgtcgcccgcccagcgcggagctctacagcaatgcactg
cctgtcgggctcccactgcccagccatgtgtccctgaccggggagagcgacggtggctac
atggacatgagcaaggatgagtctgtggactacgtgcccatgctggacatgaaaggagac
gtaaaatatgcagacatcgagtcctccaactacatggccccttatgataactacgttccc
tctgcccctgagaggacctgtcaggcgactttgatcaacgagtctccagtgcttagctac
acagacctcgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aattgtgtccacagagacctggcggccaggaacgtgctcatctgcgagggcaagctggtc
aaaatctgtgactttggcctggctcgagacatcatgcgagactcaaactacatctccaaa
ggcagcacctttctgcctttgaagtggatggccccggagagcattttcaacagcctctac
accaccctgagtgatgtgtggtccttcgggatcctgctgtgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaacgagcagttctacaatgccatcaagcggggg
taccgcatggcccagcctgcccacgcctccgatgagatctacgagatcatgcagaagtgc
tgggaagagaaatttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgctgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccattcttcggtcccaggcccgcctgcctgggttccatggcctccggtct
cccctggacaccagctccgtcctctacactgctgtgcagcccaatgagggtgacaacgac
tatatcattcccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctccaccatctcctgt
gacagccccctggagccccaggaggaatcagagccacagccccagcttgagctccaggtg
gagccggacccggagcccgagctggagcagccaccggattcagggtgcccggcacctcgg
ccagaagctgaggacagcttcctgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042318
Entry
101042318         CDS       T04350                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101042318 (CSF3R)
   04151 PI3K-Akt signaling pathway
    101042318 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101042318 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101042318 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101042318 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101042318 (CSF3R)
   04090 CD molecules [BR:sbq04090]
    101042318 (CSF3R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101042318 (CSF3R)
CD molecules [BR:sbq04090]
 Proteins
  101042318 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101042318
NCBI-ProteinID: XP_010346371
LinkDB
Position
Unknown
AA seq 836 aa
MARLRNFSLTWAALIILLLSGSLEGCGHINVSAPIVRLGDPITASCIITQKCSHLDPESQ
ILWRLGADLQPGGKQQRLSDGTQESTITLPHLNHTRAFLSCCLNWSNTVQILDQVELHAG
YPPAVPRNLSCLMNLTTNSLNCQWEPGPETHLPTNITLKSFKSRANCQTQEDSIRDCVPK
DGQSRCSIPRRHLLLYQNMVIWVQAENALGTSMSLQLCLNPMDVVKLEPPMLRTPDPNPE
APPPEPGCLHLCWEPWKPGLFINQKCELRHKPQRGDASWALVGPLPSEAFQYELCGLLPA
TTYTLQIRCIRWPLPGLWSNWSPNLELRTTERAPTVRLDIWWRQRQQDPRTVQLFWKPVP
LEEDSGQIQGYLVSWRPSGQAVAVLPLCNTTELSCTFHLPSEAQEVTLEAYNSAGTSRPS
PVAFSESRGPALTRLHATARDPHSLWVGWERPSPQPQGYVIEWGPGPSSTSNSNQTWRME
QSGSVTGFLLKENIRPFQLYEITVTPLYQDAMGHSQHVYAYSQERGPSRAPELRLNHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQFFSTILNASSSGFVLHGLKPASLYHVHL
MAVSKAGAVNSTVLNLMTLTPEGSELHILLGLFGLLLLLTCLCGTVWLCCSPNRKNPLWP
NVPDPAHSSLGSWVPTTMEEEAFQLPSLGTPPITKLTVLEEEKKKPVPWESHNSSETCGL
PTLVQPYVLQRDPRAASTQPQSQSGTRDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLGGV
SPSPKSYENLWFQASPLGTLAAPAPSQEDDCVFGPLLDFPLLQGIKVHGVEGLGNF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgagaaacttcagcctgacttgggctgccctgatcatcctgctgctctcc
ggaagtctggaggggtgtgggcacatcaatgtctcggcccccatcgtccgcctgggggat
cccatcacggcctcctgcatcatcacgcagaaatgcagccatctggacccggagtcacag
attctttggagactgggagcagatcttcagcctggtgggaagcagcagcgtctgtctgat
gggacccaggaatctaccatcaccctgccccacctcaaccacactcgggcctttctctcc
tgctgcctgaactggagcaacaccgtgcagatcctggaccaggttgagctgcacgcaggc
taccctccagctgtaccccgcaacctctcctgcctcatgaacctcacaaccaacagcctc
aactgccagtgggagccaggacctgagacccacctacccaccaacatcactctgaagagc
ttcaagagccgggccaactgtcagacccaagaggactccatccgggactgtgtgcccaag
gatgggcagagccgctgctccatcccacgcagacacctgctgttgtaccagaatatggtc
atctgggtgcaggcagagaacgcactggggaccagcatgtcgctacaactgtgccttaat
cccatggacgttgtgaaactggagccccccatgctgcggaccccagaccccaaccctgaa
gcgccccctcccgagccaggctgcctacacttgtgctgggagccatggaagccaggcctg
tttataaatcaaaagtgtgagctgcgccacaagccacagcgtggagatgccagctgggca
ctggtgggccccctgccctcagaggcctttcagtatgagctctgtgggctcctcccagcc
acaacctacaccctgcagatacgttgcatccgctggcccctgcctggcctttggagcaac
tggagccccaacctggagctgagaactactgaacgggcccccactgtcagactggacata
tggtggcggcagaggcagcaggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaagaagacagtggacagatccaaggttacctggtttcttggagaccctcaggccag
gctgtggccgtcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtgaccctcgaggcttataactcagctgggacctctcgtcccagc
ccagtggccttctcagagagcagaggcccagccctgaccagactccatgccacggcccga
gaccctcacagcctctgggttggctgggagcgccccagtccacagcctcagggctacgtg
attgaatggggcccgggcccctccagcacaagcaacagcaaccagacctggaggatggaa
cagagcgggagcgtcacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcactgtgactcccttgtaccaggacgccatgggacactcccaacatgtctacgcc
tactcccaagaaaggggcccctcccgtgccccagagcttcgtctaaaccacattggcaag
acctgggcacagctggagtgggtgcccgagccccctgagctggggaagagtcccctgacc
cactacaccatcttttggaccaacgctcagaaccagttcttctccaccatcctgaatgcc
tcgtccagtggctttgtcctccatggcctgaagcccgccagtctgtatcacgtccacctc
atggccgtcagcaaggctggggccgtcaacagtacagtcctcaacctgatgaccttgacc
ccagaagggtctgagctacacatcctcctgggcctgttcggcctcctgctcctgctcacc
tgtctctgtggaactgtctggctctgctgcagccccaacaggaagaatcccctctggcca
aatgtcccagatccagctcacagcagcctgggctcctgggtgcccaccaccatggaggag
gaggccttccagctgcccagcctcggcacgccacccatcaccaagctcacagtgctggag
gaggagaagaagaagccggtgccctgggagtcccataacagctcagagacttgtggcctc
cccactctggtccagccctatgtgctccagagggacccaagagcagcttccacccagccc
caatcccagtctggcaccagggatcaggtcctttacgggcagctgctgggcagccccaca
agcccagggccagggcactacctccgctgcgactccactcagcccctcttggggggtgtc
agccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gcagccccagccccaagccaggaggatgactgcgtctttgggccactgctcgacttcccc
ctcctgcaggggatcaaggtccatggggtggaggggctggggaacttctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042350
Entry
101042350         CDS       T04350                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101042350 (GHR)
   04151 PI3K-Akt signaling pathway
    101042350 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101042350 (GHR)
   04060 Cytokine-cytokine receptor interaction
    101042350 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101042350 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101042350 (GHR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101042350 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101042350
NCBI-ProteinID: XP_010334947
UniProt: A0A2K6TI52
LinkDB
Position
Unknown
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGRETTAAVLSRVSQSLLSVNPGLKTNSSKEPKFTKCRSPE
LETFSCRWTDAVHHGLKSPGPIQLFYTRRNTQEGTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDQIVQPDPPIALNWTLLNISLTGVHADIQVRWEAPSN
ADIQKGWMVLEYELQYKEVNETQWKMMDPILSTSVPLYSLRVDKEYEVRVRSRQRKSENY
GEFSEVLYVKLPQMSQFTCEEDFYYPWLLIIIFGISGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIEDPDEKTEGL
DTDRLLSSDHEKSRSNLGVKDGDSGRTSCYEPDMLETDFNANDINDGTSEVVQPQRLKGE
ADLLCLDQKNQNNSPYHDACPAIHQPSVIQAEKNKPQPLLTDGAESTHQAAHIQLSNPSS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQWDMHPEVVSLCQANFIMDNAYFCEADA
KKCIPVTPHIKVESHTEPSFNQEDIYITTESLTTTARRPGTAEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggacgtgaaaccacagcagctgtccttagcagagtatcccagagtctgctaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcacgaagtgccgttcacctgag
ctagagactttttcatgccgctggacagacgcagttcatcatggtttaaagagtccagga
cccatacagctgttctatactaggaggaacactcaagaagggactcaagaatggaaagaa
tgtcctgattatgtttctgctggggaaaacagctgttattttaattcatcgtttacctcc
atctggataccttactgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgaccaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacatcagtttaactggggttcatgcagacatccaagtgagatgggaagcaccatccaat
gcagatattcagaaaggatggatggttctagagtatgaacttcaatacaaagaagtaaat
gaaactcagtggaaaatgatggaccctatattgtcaacatcagttccactgtactcattg
agagtggataaggaatatgaagtgcgtgtgagatccagacaacgaaaatctgaaaattat
ggcgagttcagcgaggtgctgtacgtaaaacttcctcagatgagccagtttacatgtgaa
gaagatttctactatccatggctcttaattattatctttggaatatctgggctaacagtg
atgctatttgtatttttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaattgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacctgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgaggacccagatgaaaagactgagggatta
gacacagacagacttctaagcagtgaccatgagaaatcacgtagtaacctaggggtgaag
gacggcgactctggacgtaccagctgttatgaacctgacatgctggagactgatttcaat
gccaatgacataaatgatggtacctcagaggttgttcagccacagaggttaaaaggggaa
gcagatctcttgtgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctattcatcagcccagtgttatccaagcagagaaaaacaaaccgcaaccacttctt
actgatggggccgagtcaactcatcaagctgcccatattcagctaagcaatccaagttca
ctggcaaacattgacttttatgcccaggtgagcgacattacaccagcagggagtgtggtc
ctttcaccgggccaaaagaataaggcagggatgtcccagtgggacatgcatccagaagtg
gtctcactctgccaagcaaacttcattatggacaatgcctacttctgcgaggcagatgcc
aaaaagtgcatccctgtgactcctcacatcaaggttgaatcacacacagagccaagcttt
aaccaagaggacatttatatcaccacagagagccttaccactactgccaggaggcctggg
acagcagaacacgttccaggttctgagatgcctgtcccagattatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcgtgtggctatgtgagcacagaccaactaaacaaaatcatgccttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044161
Entry
101044161         CDS       T04350                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
sbq05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101044161 (IL7R)
   04068 FoxO signaling pathway
    101044161 (IL7R)
   04151 PI3K-Akt signaling pathway
    101044161 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101044161 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101044161 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044161 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    101044161 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101044161 (IL7R)
   04090 CD molecules [BR:sbq04090]
    101044161 (IL7R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101044161 (IL7R)
CD molecules [BR:sbq04090]
 Proteins
  101044161 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 PTP_tm
Other DBs
NCBI-GeneID: 101044161
NCBI-ProteinID: XP_003925977
UniProt: A0A2K6UI02
LinkDB
Position
Unknown
AA seq 459 aa
MTILGTTFAVFFSLLQVVSGESGHAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNTTNLEFEICGALVEVRCLNFRKLQEIYLIETKKFLLIGNSEICVKAGEKSLTCKN
VNLATIVKPEAPFDLSVIYREGANDFLVTFNTSHLQKKYVKVLMHDVAYRHEKDENNWMH
VNLSSTKLTLLQRMLQPKATYEIKVRSIPHYYFKGFWSEWSPSYYFRTPEINNHSGETNP
ILLTISILSVFSVVLLVILACVLWKKRIKPIIWPSLPDHKKTLEHLCKKPRKNLIVSFNP
ESFLDCQIHRVDDIQARDEAEGFLQDMVPPQLEESETQRPEGDVQSPNWPSEDVVTTAET
FGRDPPLGCLAGNVSACDAPILSSSRPLECRESGANGSHVNQDLLLSLGTTNSTLPPSFP
LQSRILTLNPVAQGQPILTFLGSNKEEAYVTMSSFYQNR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttgctgtatttttttctttacttcaagtcgtttctgga
gaaagtggccatgcacagaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcccagcactcgctgacctgtgcttttgag
gacccagatgtcaacaccaccaatctggaatttgaaatatgtggggccctcgtggaggta
aggtgcctgaatttcaggaaactacaagagatatatctcattgaaacaaagaaattccta
ttgatcggaaatagtgagatatgtgtgaaggctggagaaaagagtctaacctgcaaaaac
gtaaacctagccactatagttaaacctgaggctccttttgacctaagtgtcatctatcgt
gaaggagccaatgactttctggtgacgttcaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcatgatgtagcttaccgccacgaaaaagatgagaacaactggatgcac
gtgaatttatccagcacaaagctgacactcttgcagagaatgctccaaccaaaagcaacg
tatgagattaaagttcgatccatccctcattactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaacgccagagatcaataatcactcaggggagacaaatcct
atcttactaaccatcagcattttgagtgttttctctgtggttctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctattatatggcctagtctcccagatcataag
aagactctggaacatctgtgtaagaaaccaagaaagaatttaattgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagcg
gaaggctttctgcaagatatggttcctccacaactagaagaatctgagacgcagaggcct
gaaggggacgtgcagagccccaactggccatctgaggatgtagtcaccaccgcagaaact
tttggaagagatccacccctcggatgcctggctgggaatgtcagtgcatgtgatgcccct
atactctcctcttccaggcccctagagtgcagagagagtggcgcaaatgggtctcatgtg
aaccaggacctcctccttagcctcggaactacaaacagcaccctgccaccttcattccct
ctccaatccagaatcctgacattgaacccagttgctcaggggcagcccatccttactttc
ctgggatcaaacaaagaagaagcatacgtcaccatgtccagcttctaccaaaaccggtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044733
Entry
101044733         CDS       T04350                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101044733 (IL4R)
   04151 PI3K-Akt signaling pathway
    101044733 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101044733 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101044733 (IL4R)
   04658 Th1 and Th2 cell differentiation
    101044733 (IL4R)
   04659 Th17 cell differentiation
    101044733 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044733 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101044733 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101044733 (IL4R)
   04090 CD molecules [BR:sbq04090]
    101044733 (IL4R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101044733 (IL4R)
CD molecules [BR:sbq04090]
 Proteins
  101044733 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3 Terpene_synth_C
Other DBs
NCBI-GeneID: 101044733
NCBI-ProteinID: XP_003930268
UniProt: A0A2K6TH83
LinkDB
Position
Unknown
AA seq 830 aa
MPRRLPMGWLCFGLLFPVSCLVLLQVAGSGSMKVLQEPTCVSDYISLSTCEWKMGGPTNC
SAELHLSYQLVFLISEAYTCVPENNGGAGCVCHLFMEDMVGADNYTLDLWAGQQLLWKGS
FKPSEHVKPKAPENLTVYTNISETLLLTWSNPYPPDNYLYKKLTYAVNIWNENNPADSRI
YDVTYQEPTLHIAASTLKSGVSYRARVRAWAQSYNSTWSEWSPSTKWHNTYKEPFEKHLR
LGVSVSCVAILAICLLCYVSIVKIKKEWWDQIPTPARSPLVAIVIQDPQVSQWEKRPRGQ
EPAKCPHWKTCLTKLLPCFLEHSIKRDEDPLKAAKDRPFQGSGKSAWCPVEISKTVLWPE
SISVVRCVELFEAPVECEEEEVEEDKGSFCALPESSRDGFQEGREAIVARLTESLFLDLL
GGENGDFCQQDMRESCLLAPSGSVSAHMPWDEFPSVGPKEEPPRGEEQPLHLEPSPPGSP
TRSPDNPTCTETPLVIADNPAYRSLDDSLSQSPCPGGLGPDPLLARHLEEVDPEMPCALQ
PSEPTSVSPPEPETWEQILRRNVLQHGAAAAPASAPSSGYREFAHAVEQGGILAGAVGGL
GPPGEAAYKAFSGLLASNAVSPGTYGFGASSGEEGYKPFQDLIPGCPEDPAPVPVPLFTF
GLDREPPRSPQSSHLPGSSPEQLGLEPGVKGEDTWKPPLLLEQATDPLGDSLGSGIVYSA
LTCHLCGHLKQCHGQEDGGQAPVVASPCCGCCCGDRSSPPTTPLRVPDPSPGEVPLEASL
RPASPAPLGISEKSESPLSFHPAPGSAQSSIQISKIMNFVSGEPTCMRVS
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgcctcggcgtctcccaatggggtggctttgctttgggctcctgttccctgtgagctgc
ctggttctgctgcaggtggcaggctctgggagcatgaaagtcctgcaggagcccacctgc
gtctccgactacatcagcctctctacctgcgagtggaagatgggcggtcccaccaattgc
agcgcagagctccacctgtcctaccagctggtttttctgatttccgaagcctacacgtgt
gtccccgagaacaacggaggcgcggggtgcgtgtgccacctgttcatggaggacatggtc
ggagcggacaactatacgctggacctgtgggctgggcagcagctgctgtggaaaggctcc
ttcaagcccagcgagcacgtgaaacccaaggctccagaaaacctcacggtttacaccaac
atctctgagactctgctgctgacttggagtaacccgtatccccctgataattacctgtat
aagaagcttacctatgcagtcaacatttggaatgaaaacaacccggcagattccagaatc
tatgatgtgacctaccaagaacccaccctccacatcgcagccagcaccctgaaatctggg
gtttcctacagggcacgggtgagggcctgggctcagagctataacagcacctggagtgag
tggagccccagcaccaagtggcataatacctacaaggagcccttcgagaagcaccttcgg
ctgggcgtcagtgtctcctgcgttgccatcctggccatctgcctgttgtgctatgtcagc
atcgtcaagattaagaaagaatggtgggaccagattcccaccccagctcgcagcccccta
gtggctatagtcatccaggatcctcaggtgtcacagtgggagaagcgacctcgaggccag
gaaccagccaagtgcccacactggaagacttgtcttaccaagctcttgccctgttttctg
gagcacagcataaaaagggatgaagatcccctcaaggctgccaaagataggcctttccag
ggctctggaaaatcagcatggtgccctgtggagatcagcaagacagtcctctggccagag
agcatcagcgtggtgcggtgcgtggagttgtttgaggccccggtggagtgtgaggaggag
gaggtagaggaagataaagggagtttctgtgcattgccagagagcagcagggatggcttc
caggagggcagggaggccattgtggcccggctcacagagagcctcttcctggacctgctc
ggaggtgagaatggggacttttgccagcaggacatgagggagtcgtgcctccttgcacct
tcaggaagcgtgagtgctcacatgccctgggatgagttcccaagtgtagggcccaaggag
gagcctccccggggtgaggagcagcctctgcacctggagccgagtcctcctggcagcccg
acccggagcccagacaacccgacttgcacagagacgcccctggtcatcgcagacaacccc
gcttaccgcagcctcgacgactccctgagccagtccccatgtcccggagggctgggtcca
gacccactgctggccagacacctggaggaagtggaccccgagatgccttgtgccctgcag
ccctccgagccaaccagtgtgtcccctcccgagccagaaacctgggagcaaatcctccgc
cggaatgtcctccagcatggggcggctgcagcccccgcctcagcccccagcagtggctat
cgggagttcgcacatgcggtggaacagggtggcatcctggccggtgcggtggggggcttg
ggtcccccgggagaggcggcgtacaaggccttctcgggcctgcttgccagcaatgccgtg
tccccagggacatacggatttggggccagcagtggggaggaggggtataagcctttccaa
gatctcattcctggctgccccgaggaccctgccccagtccctgtccccctgttcaccttt
ggactggacagggagccacctcgcagcccacagagctcccatctcccaggcagctcccca
gagcaactgggtctggagccaggggtaaaaggagaggacacgtggaagcccccactcctc
ctggagcaggccacagatccccttggggacagcctgggcagtggcatcgtctactcagcc
ctcacctgccacctgtgcggccacctgaagcagtgtcacggccaggaggatggtggccag
gcccctgttgtggccagcccctgctgtggctgctgctgtggagataggtcgtcgccccct
acgacccccctgagggtcccagacccctctccaggtgaggttccactggaggccagcctc
cgcccggcctccccggcacccttgggcatctcagagaagagtgaatccccattgtccttc
catcctgcccctggcagtgctcagagctcgatccagatctccaaaatcatgaactttgtc
tccggggaacccacgtgcatgagggtctcttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044811
Entry
101044811         CDS       T04350                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha isoform X1
  KO
K19598  interleukin 27 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101044811 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101044811 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101044811 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101044811 (IL27RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101044811 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 101044811
NCBI-ProteinID: XP_010350796
LinkDB
Position
Unknown
AA seq 588 aa
MRGGRGAPFRPWPLSKLALLPLLWVLFQRTRPQGSAGPLQCHGVGPFGDLNCSWEPLGDL
GAPSKLHLQSQKYGSNKTQTVAVVAGQSWVSIPREQLTTSDKLLVWGTKTDQSLWPPVFV
DLETQMKPNAPRLGPDVDFSEDDPLEATVHWTPPTWPSHKVLICQFHYRRCQEVAWTLPP
EPCVQVSYNVWFWVGGRELSLEGITCCNSSIPSGAEWASVSAVNATSWEPLTKLSLVCLD
SASAPHSVAVSSIAESTELLVTWQPGPGEPQEHVVDWVGDGDPLEKLNWVRLPPGNLSAL
LPGNFTVGIPYRITVTTVSASGLASAPPVWGFREELTPLVGPTLWRLQDAPPGTPAIAWG
EVPRHQLRGHLTHYTLCSRSGNRPSVCMNVSCDTQSVTLPDLPWGPCELWVMASTIAGQG
PPGPILRLHLPDNTLKWKVLPGLLFLWVLFLMGCGLRLATSGRCHHLRHKMLPRWIWEKV
PDPANSSSGQPHMESLRPSPLGTSPYWKWRRWSHHRRLWSPPSTPRPLPRLTLGMRSTSC
PRPRSWGFWGPSGHRLWPEPHLWLEAASQARGVLMQAAPQSWISPLDG
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcggggaggcaggggcgcccctttccggccgtggccgctgtccaagctggcgctgctg
cctctattgtgggtgcttttccagcggacgcgtccccagggcagcgccgggccactgcag
tgccacggagttgggcccttcggcgacttgaactgctcatgggagcctcttggggacctg
ggagccccctccaagttacacctccagagtcaaaagtacggttccaacaaaacccagacg
gtggcagtggtggccgggcagagctgggtgtccattcctcgggaacagctcaccacgtct
gacaaactccttgtctggggaactaagacagaccagtctctctggccccccgtcttcgtg
gacctggaaacccaaatgaagccgaacgccccccggctgggtcctgatgtggacttttct
gaggatgaccccctggaggccactgtccactggaccccacctacgtggccatctcataaa
gttctgatctgccagttccactaccgaagatgccaggaggtggcctggaccctgccccca
gagccctgtgtgcaggtgagctacaatgtctggttctgggttggagggcgtgagctgagt
ctggaaggaattacctgctgcaattcctctattcccagcggggcagagtgggccagcgtg
tctgctgtcaacgccacaagctgggagcctctcaccaagctctctctggtctgcttggat
tcagcctctgccccccacagcgtggcggtcagcagcatcgctgagagcacggagctactg
gtgacctggcagccggggcctggggagccacaggagcacgtggtggactgggttggagat
ggggaccccctagagaaactcaactgggtccggcttccccctgggaacctcagtgctctg
ttaccagggaatttcacggtcgggatcccctatcgaatcactgtgaccacagtctctgct
tcgggcttggcctcggcacctcccgtctgggggttcagagaggaactaacacccctagta
ggcccaacactttggcgactccaagatgcccctccagggacccctgccatagcatgggga
gaggtcccaaggcaccagcttcggggccacctcacccactacaccttgtgttcacggagt
ggaaaccgcccctccgtctgcatgaatgtgagttgcgacacacagagtgtcaccctgcct
gaccttccttggggtccctgtgagctgtgggtgatggcatccaccattgctggacaaggc
cctcctggtcccatcctccggcttcacctaccagataacaccctgaagtggaaagttctg
ccgggcctcctgttcttgtgggtcttattcctgatgggctgtggcctgaggctggccacc
tctggaaggtgccaccacctacggcacaagatgctgccccgctggatctgggagaaggtt
cctgatcctgccaacagcagttcaggccagccccacatggagtccctgaggcccagtccc
ttggggacttccccatactggaagtggaggagatggagccaccaccgccggttatggagt
ccccccagcacccccaggccactgccccgcttgactctgggtatgagaagcacttcctgc
ccacgcccgaggagctggggcttctggggcccctcaggccacaggttatggcctgaacct
cacctctggctggaggctgccagccaggccagaggggtgctcatgcaggctgcaccccag
tcctggattagccctcttgatggatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045058
Entry
101045058         CDS       T04350                                 

Gene name
IL21R
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101045058 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101045058 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101045058 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101045058 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101045058 (IL21R)
   04090 CD molecules [BR:sbq04090]
    101045058 (IL21R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101045058 (IL21R)
CD molecules [BR:sbq04090]
 Proteins
  101045058 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Other DBs
NCBI-GeneID: 101045058
NCBI-ProteinID: XP_010339115
LinkDB
Position
Unknown
AA seq 538 aa
MPRGSAVALLLLLLQGGWGCPALVCYTDYLQTVICILEMWSLHPSTLTLTWQDQYEELKD
EVTSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFVLADSIKP
APPFNVTVTFSGQYNISWRSDYEDPDFFMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFCKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWGLKTHPAWRLWKKTWVVPSPENFFLPLYKCYGGDFKKWVGAPLTASI
LELGPWSPEVPSALEVYSYHLPRSPAKRLQLTELREPAELVESDSVPKPSSWATAQNSGG
SAYSEERDRPYGLLSIDTVTVLDAEGLCTGPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
ADTTVLSCGCVSAGSPGLGGPLGSLLDRLRPPLADGEDWAGGLPWGGRSPGGALESEAGS
PPAGLDMDTFDSGFAGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPXTLSSPGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgccacgtggctcggccgtcgccttgctcctgctgctgctccagggaggctggggctgc
cccgccctcgtctgctacacagattatctccagacggtcatctgcatcctggagatgtgg
agcctccaccccagcacgctgaccctcacctggcaagaccagtatgaagagctgaaggac
gaggtcacctcctgcagcctccacaggtcggcccacaacgccacgcatgccacgtatacc
tgccacatggatgtgttccacttcatggccgatgacattttcagtgtcaacatcacagat
cagtctggcaactactcccaggagtgtggcagctttgtcctggctgacagcatcaagccg
gctccccctttcaacgtcaccgtgaccttctcaggacagtataatatctcctggcgctcg
gattacgaagaccctgacttcttcatgctgaagggcaagcttcagtatgagctacagtac
aggaaccggggagacccctgggctgtgagtccaaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccttggagttctgcaaagactcgagctatgagctgcaggtg
cgagcagggcccatgcctggctcctcctaccaggggacctggagcgagtggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggggcctgaagacccacccagcc
tggaggctgtggaagaagacatgggtcgtccccagtcccgagaatttcttcctgcctctg
tacaagtgctacggaggagacttcaagaaatgggtgggtgcacccctcaccgcctccatc
ctggagctgggaccctggagcccagaggtgccctcagccctggaggtgtacagttaccac
ttgccacggagtccggccaagaggctgcagctcacggagctgcgagaaccggcagagctg
gtggagtctgacagtgtgcccaagcccagctcctgggccacggcccagaactccgggggc
tcagcttacagcgaggagagggaccggccgtacggcctgctgtccatcgacacagtgact
gtgctagatgcagaggggctgtgcaccgggccttgcagctgtgaggatgacggctaccca
gccctggatctggacgccggccttgagcccagcccaggcctagaggacccactcttggac
gcggacaccacagtcctctcctgtggctgtgtctcggctggcagtcctgggctaggaggg
cccctgggaagcctcctggacagactaaggccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggccttagagagtgaggcgggctcg
cccccggccggcctggatatggacacgtttgacagtggcttcgcgggctctgactgcagc
agccctgtggagtgtgacttcaccagtcctggggacgaaggcccgccccggagctacctc
cgccagtgggtggtcatccctncaacactctcgagccctggaccccaggccagctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045141
Entry
101045141         CDS       T04350                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101045141 (PRLR)
   04151 PI3K-Akt signaling pathway
    101045141 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101045141 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    101045141 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101045141 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101045141 (PRLR)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101045141 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP Tissue_fac Y_Y_Y Interfer-bind
Other DBs
NCBI-GeneID: 101045141
NCBI-ProteinID: XP_003925979
UniProt: A0A2K6TC05
LinkDB
Position
Unknown
AA seq 618 aa
MKENVASATVFTLLLFLNTCLLNGQSPPGKPEVFKCRSPNKETFTCWWRPGADGGLPTNY
SLTYHKEGETLIHECPDYVTGGPHSCHFGKQYTSMWRTYVITVNATNKMGSTLSDELYVD
VTYIVQPDPPLNVVVEVKQPEDKKPYLWIKWSPPTLIDLKTGWFTLLYEIQLKPENAEEW
ETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSSWSPEYSIQIPSEFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMATCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHSSQGMKPTHLEPDTDSGRGSCDSPSLL
SEKCEEPQTSPSTFCAPEVIEKPENPETTHTWDPQCRSMEGKTPSFHAGGSKCSTWPLPQ
PSQHNPRSSYHNIADACELAVGPAGAPATPLDKAGKDALKSSQVSKPREEGKAAQQKEVE
SFHSKTDWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKPGNNGSQPEKPKDPENSK
EYAKVSRVMDNNILVLVPDPHTKNVACFEESAKEAPPSLEQNHAEKGLADFTATPSNCRL
QLGGLDYLDPACFTHSFH
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaactgttttcactctgctgctttttctcaacacttgt
cttctgaatggacagtcacctcctgggaaacctgaggtctttaaatgtcgttctcccaat
aaggaaacgttcacctgctggtggaggcctggagcagatggaggacttcctaccaattat
tcactgacttaccacaaggaaggagagacactgatacatgaatgtccagactacgtaacc
ggtggcccccactcctgccactttggcaagcagtacacctccatgtggaggacatacgtc
atcacagtcaacgctactaacaagatgggaagcactttgtcagatgaactctacgtggac
gtgacttacatagttcaaccagaccctcctctgaatgtggttgtggaagtaaaacagcca
gaagacaaaaaaccctatctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctatatgaaattcaattaaaacccgagaatgcagaggaatgg
gagacccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaatatcttgtccaggttcgctgcaagccagaccatggatactggagttcatggagtcca
gaatactccattcagatacctagtgagttcaccatgaacgatacaaccgtgtggatctct
gtggctgttctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggcgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagcgccctgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgacagt
gaggaccagcatctaatgtcagtccattcaaaagaacactcaagtcaaggtatgaaaccc
acacacctggaacctgacactgactcaggccgggggagctgtgacagcccctcccttttg
tctgaaaagtgcgaggaaccccagaccagtccctccacattctgtgctcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggaccctcagtgcagaagcatggaa
ggcaaaaccccctcctttcatgctggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaacattgctgatgcgtgtgagctggct
gtgggccccgcaggtgcaccagccactccgttggacaaagcaggcaaagatgctttaaag
tcctctcaagtcagtaagcctagagaggagggaaaggcagcccagcagaaggaggtagaa
agcttccattctaagactgactggctgttgccccaggagaaaaccccctttggctccgct
aaacccttggattatgtggagattcacaaggtcaacaaagatggcgcactatcattgcta
ccaaaaccaggaaataacggcagccagcctgagaagcccaaggatcctgagaacagtaag
gagtatgccaaggtgtccagggtcatggataacaacatcctggtgttggtgccggatccg
cacactaaaaacgtggcctgctttgaagaatcagccaaagaggccccaccgtcacttgaa
cagaatcacgctgagaaaggcctggccgacttcactgcgacaccaagcaactgcaggctc
cagctgggtggtttggattacctggatcccgcatgttttacacactcctttcattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045372
Entry
101045372         CDS       T04350                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101045372 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101045372 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045372 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101045372 (IL13RA1)
   04090 CD molecules [BR:sbq04090]
    101045372 (IL13RA1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101045372 (IL13RA1)
CD molecules [BR:sbq04090]
 Proteins
  101045372 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 GP88 LIFR_N
Other DBs
NCBI-GeneID: 101045372
NCBI-ProteinID: XP_010339994
UniProt: A0A2K6S5Y6
LinkDB
Position
Unknown
AA seq 425 aa
MERPARLCGLWALLLCAVGRGGGAAPTETQPPVTNLSVSVENLCTVVWTWNPPEGASPNC
SLWYFSHFGDKQDKKIAPETHRSKEVPLNEKICLQVGSQCSTNESEKPSILVEKCISPPE
GDPESAVTELQCVWHNLSYMKCSWLPGRNASPDTNYTLYYWHSNLEKIHQCEKIYKDNQY
FGCSFDLTKVKDSSFEKNSVQIMVKDNAGKIRPSFKIVPLTSRVKPDPPHIKKLFFHNGN
LYVQWEDPQNFISRCLSYEVQVNNSQTETLVFNVKDEAKCQNPEFERNMENTSCFMVPGV
LPDTSSAVRIRVKTNEFCYEDDKLWSNWSQEMTIGKKRNSTLYITMLLIVPVIVAGAIIV
LLVYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENL
KKASQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagcggccggcgcggctctgcgggctgtgggcgctgctgctttgcgcagtcggcagg
ggtgggggcgccgcgcccacggaaactcaaccacctgtgacaaatttgagtgtctctgtt
gaaaacctctgcacagtagtatggacgtggaatccaccagagggagccagcccaaattgt
agtctatggtattttagtcattttggcgacaagcaggataagaaaatagctccagaaact
catcgttcaaaagaagtgcccttgaatgagaagatttgtctgcaagtgggatcccagtgt
agcaccaatgaaagtgagaagcctagcattttggttgaaaaatgcatctcacccccagaa
ggcgatcctgagtctgctgtgactgagcttcaatgtgtttggcacaacctgagctacatg
aagtgttcatggctccctggaaggaatgccagtcctgacacgaactatactctctactat
tggcacagcaacctggaaaaaattcatcaatgtgaaaagatctataaagataaccaatac
tttggttgttcctttgatctgaccaaagtgaaggattccagttttgaaaaaaacagtgtc
caaataatggtcaaggataatgcaggaaaaattagaccatccttcaaaatagtaccttta
acttcccgtgtgaaacctgatcctccacatattaaaaagctcttcttccataatggtaac
ctgtatgtgcaatgggaggatccacagaattttattagcagatgcttatcttatgaagta
caagtcaataacagccaaactgagacacttgttttcaacgttaaggatgaagctaaatgt
cagaatccagaatttgagagaaatatggagaatacatcttgtttcatggttcctggtgtt
cttcctgatacttcgagtgcagtcagaataagagtcaaaacaaatgaattttgctatgag
gatgacaaactctggagtaattggagccaagaaatgaccataggtaagaagcgcaattcc
accctctacataaccatgttactcatcgttccagtcatcgttgcaggtgcaatcatagta
ctgctggtttacctaaagaggctcaagatcattatattccctccaattcctgatcctggc
aagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaagaagtac
gacatctatgagaagcaaaccaaggaagaaaccgactctgtagtgctgatagaaaacctg
aagaaagcgtctcagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046140
Entry
101046140         CDS       T04350                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101046140 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101046140 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101046140 (MPL)
   04090 CD molecules [BR:sbq04090]
    101046140 (MPL)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  Prolactin receptor family
   101046140 (MPL)
CD molecules [BR:sbq04090]
 Proteins
  101046140 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind ObR_Ig
Other DBs
NCBI-GeneID: 101046140
NCBI-ProteinID: XP_010345893
LinkDB
Position
Unknown
AA seq 623 aa
MPGRTQGQLTSCSSDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYQGE
KPRACPLSSQSVPRFGTRYVCQFPDQEEVRLFFQLHLWVKNVFLNQTRTQRVLFVDTVGL
PAPPSVIKAMGGSQPGELQISWEPPAPDFSDFLKYELRYGPKDPKNSTGPTVIELIDTET
CCPTLQGLRSALVVDQPPCPQPTMPWQDGPKQTSPTREASALTAVGGSCLISGLQPGNSY
WLQLRSQPDGISLRGSWGSWSLPVTVDLPGDAVAIGLQCFTLDLKNVTCQWQQQDHASSQ
GFFYHSRARCCPRDRYPIWENCEEEEETNPGLQTPQFSRCHFKSQNDSAIHILVEVTTAL
GTVHSYLGSPFWIHQAVGLPTPNLHWREISSGYLELEWQHPSSWAAQETCYQLRYTGEDH
QDWKVVEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDSAKVETASETAWI
SLVTALFLVLGLSALLGLLLLRWKFPAHYRRLRHVLWPSLPDLHRVLGQYLRDTAAPSPP
KATVSDACEEVEPSLLEILPKSSEGTPLPMCSSRAQMNYQRLQPSCLGTMPLSVRPPMAE
SGSPRSTNIANHSYLPLSYWQQP
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgcctgggaggacccagggccaactcaccagctgttcatcagatgtctccttgctggcc
tcggactcagagcccctgaagtgtttctcccgaacatttgaggacctcacttgcttctgg
gatgaggaagaggcagcgcccagtggaacataccagctgctgtatgcctaccagggggag
aagccccgtgcctgccccctgagttcccagagcgtgccccgctttggaacccgatatgtg
tgccagtttccagaccaggaggaagtacgcctcttctttcagctgcacctctgggtgaag
aatgtgttcctgaaccagactcggacccagcgagtgctatttgtggacactgtaggcctg
ccggctccccccagtgtcatcaaggccatgggcgggagccagccaggggaactccagatc
agctgggagcccccagctccagatttcagtgatttcctgaagtacgaactccgctatggc
cccaaagatcccaagaactccactggtcccacggtcatagagctgatcgacacagaaacc
tgctgccctactctgcaggggctacgctcagcccttgttgtggaccagcctccatgtcct
caacccacaatgccctggcaagatggaccaaagcagacctccccaactagagaagcttca
gctctgactgcagtgggtggaagctgcctcatctcaggactccagcctggcaactcctac
tggctgcagctgcgcagccaacctgatgggatctccctccgtggttcctggggatcctgg
tccctccctgtgactgtggacctgcctggggatgcagtggcaattggactacaatgcttt
accttggacctgaagaatgttacctgtcaatggcagcaacaggaccatgctagctcccaa
ggcttcttctaccacagcagggcacggtgctgtcccagagacaggtaccctatctgggag
aattgtgaagaggaagaggaaacaaatccaggattacagaccccacagttctctcgctgc
cacttcaagtcacaaaatgacagtgctattcacatccttgtggaggtgaccacagccctg
ggtactgttcacagctacctgggctcccctttctggatccaccaagctgtgggcctcccc
accccaaacttgcactggagggagatctccagcgggtatctggaattggagtggcagcac
ccatcatcctgggcagcccaagagacctgctatcaactccgatacacaggagaagaccat
caggactggaaggtggtggagccgcctctcggggcccgaggaggaaccctggagctgcgc
ccgcgatctcgctaccgtttacagctgcgcgccaggctcaacggccccacctaccaaggc
ccctggagctcctggtccgactcagctaaggtggagaccgcctccgagaccgcctggatc
tccttggtgaccgctctgttccttgtgctgggcctcagcgcccttctgggcctgctgctg
ctgaggtggaagtttcctgcgcactacaggagactgaggcatgtgctgtggccctcactt
ccagacctgcaccgggtcctaggccagtaccttagggacactgcagccccaagtccgccc
aaggccacagtctcagatgcctgtgaagaagtggaacccagcctccttgaaatcctccct
aaatcctcagaagggactcctttgcccatgtgttcctcccgggcccagatgaactaccaa
agattgcagccttcttgcctggggactatgcccctgtctgtgcgcccacccatggctgag
tcagggtccccacgttccaccaacatcgccaaccattcctacctaccactaagctattgg
caacagccctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047461
Entry
101047461         CDS       T04350                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047461 (EGFR)
   04012 ErbB signaling pathway
    101047461 (EGFR)
   04014 Ras signaling pathway
    101047461 (EGFR)
   04015 Rap1 signaling pathway
    101047461 (EGFR)
   04630 JAK-STAT signaling pathway
    101047461 (EGFR)
   04066 HIF-1 signaling pathway
    101047461 (EGFR)
   04068 FoxO signaling pathway
    101047461 (EGFR)
   04020 Calcium signaling pathway
    101047461 (EGFR)
   04072 Phospholipase D signaling pathway
    101047461 (EGFR)
   04151 PI3K-Akt signaling pathway
    101047461 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101047461 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047461 (EGFR)
   04520 Adherens junction
    101047461 (EGFR)
   04540 Gap junction
    101047461 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101047461 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101047461 (EGFR)
   04915 Estrogen signaling pathway
    101047461 (EGFR)
   04921 Oxytocin signaling pathway
    101047461 (EGFR)
   04926 Relaxin signaling pathway
    101047461 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    101047461 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047461 (EGFR)
   05206 MicroRNAs in cancer
    101047461 (EGFR)
   05205 Proteoglycans in cancer
    101047461 (EGFR)
   05230 Central carbon metabolism in cancer
    101047461 (EGFR)
   05231 Choline metabolism in cancer
    101047461 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101047461 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047461 (EGFR)
   05212 Pancreatic cancer
    101047461 (EGFR)
   05225 Hepatocellular carcinoma
    101047461 (EGFR)
   05226 Gastric cancer
    101047461 (EGFR)
   05214 Glioma
    101047461 (EGFR)
   05218 Melanoma
    101047461 (EGFR)
   05219 Bladder cancer
    101047461 (EGFR)
   05215 Prostate cancer
    101047461 (EGFR)
   05213 Endometrial cancer
    101047461 (EGFR)
   05224 Breast cancer
    101047461 (EGFR)
   05223 Non-small cell lung cancer
    101047461 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047461 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101047461 (EGFR)
   05171 Coronavirus disease - COVID-19
    101047461 (EGFR)
   05163 Human cytomegalovirus infection
    101047461 (EGFR)
   05165 Human papillomavirus infection
    101047461 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047461 (EGFR)
   01522 Endocrine resistance
    101047461 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047461 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101047461 (EGFR)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101047461 (EGFR)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101047461 (EGFR)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101047461 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   101047461 (EGFR)
  Exosomal proteins of bladder cancer cells
   101047461 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 101047461
NCBI-ProteinID: XP_010330053
UniProt: A0A2K6TTC6
LinkDB
Position
Unknown
AA seq 1157 aa
MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMFY
ENSYALAVLSNYDANKMGLKELPMRNLQEILHGAVRFSNNPALCNVDSIQWRDIVSNDFL
SNMSMDFQNHVAGCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACGADSYEVEEDGVRKCKKCEGPCRKVCNGIGIGKFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYAN
TINWKKLFGTSSQKTKIINNRGENSCKATGHVCHSLCSSEGCWGPDPRDCVSCRNVSRGR
ECVEKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDSCIQCAHYIDGPHCVK
TCPAGVMGENNTLVWKYADAGHVCHLCHSNCTYGCGGPGLEGCAIPGPKIPSIATGIVAA
LLLVLVVALGIGLFMRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA
DEYLIPQQGFFSSPSTSRTPLLSSLSANSNNSTVACIDRNGLQTCPIKEDSFLQRYSSDP
TGALTEDSIDDSFLPVPEYINQCVPKRPAGSVQNPVYHNQPLNLAPSRDPHYQDPHSTAV
GNPEYLNTVQPTWVSSAVDSPDRWIQKAIHQISLDNPDYQQDFLPKEAKPNGMFKGPTAE
NAEYLRVAPQSSEFIGA
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctacgtgcagaggaat
tatgatctttccttcttaaagaccatccaggaggtggctggttatgtactcatcgccctc
aacacagtggagcggattcctttggaaaacctgcagatcatcagaggaaatatgttctac
gaaaattcctatgccttagcagtcttatccaactatgatgcaaataaaatgggactgaag
gagctgcccatgagaaacttacaagaaatcctgcatggcgctgtgcggttcagcaacaac
cctgccctgtgcaacgtggacagcatccagtggcgggacatcgtcagcaacgactttctc
agcaacatgtcgatggacttccagaaccacgtggctggctgccaaaagtgtgatccaagc
tgtcccaatgggagctgctggggtgcaggggaggagaactgccagaaactgaccaaaatc
atctgtgcccagcagtgctccgggcgttgccgcggcaagtcccccagcgactgctgccac
aaccagtgtgccgcaggctgcacgggcccccgagagagtgactgcctggtctgccgcaaa
ttccgagacgaagccacatgcaaggacacctgccccccactcatgctctacaaccccacc
acatatcagatggacgtgaaccctgagggcaaatacagctttggtgccacctgcgtgaag
aagtgtccccgtaactatgtggtgacagatcacggctcgtgcgtccgagcctgcggggcc
gacagctacgaggtggaggaagacggcgtgcgcaagtgtaagaagtgtgaagggccttgc
cgcaaagtgtgtaacggaataggtattggtaaatttaaagacacgctctccataaatgct
acaaatattaaacacttcaaaaactgcacctccatcagcggtgatctccacatcctgccg
gtggcatttaggggtgactccttcacacacactccacctctggatccaaaggaactggat
attctgaaaaccgttaaggaaatcacagggtttttgctgattcaggcttggcctgaaaac
aggacggacctccatgcttttgagaacctggaaatcatacgcggcaggaccaagcaacat
ggtcagttttctcttgctgttgtcagcctgaacataacatccttgggattacgctccctc
aaggagataagcgatggagatgtgatcatttcaggaaacaaaaatttgtgctatgcaaat
acaataaactggaaaaaactgtttgggacctccagccagaaaaccaaaattataaacaac
agaggtgaaaacagctgcaaggccacaggccatgtctgccattctttgtgctcctccgag
ggctgctggggcccggaccccagggactgcgtctcctgtcggaacgtcagccggggcaga
gagtgcgtggagaagtgcaacattctggagggcgagccaagagagtttgtggagaactct
gagtgcatccagtgccacccggaatgcctgccccaggccatgaacatcacctgcacggga
cgggggccggacagctgcatccagtgtgcccactacatcgacggcccccactgcgtcaag
acctgcccggcaggggtcatgggagaaaacaacaccctggtctggaagtacgcggacgcc
ggccacgtgtgccacctgtgccattcaaactgcacctacggatgcggtgggccaggtctt
gaaggctgtgcaatacctgggcccaagatcccgtccatcgccactgggattgtggctgcc
ctcctgttggtgctggtggtggccctggggatcggcctcttcatgcggaggcgccgcatt
gtccgaaagcgcacgctgcggaggctgctgcaggagcgggagctcgtggagcctcttacg
cccagcggagaagctcctaaccaagccctcctgaggatcttgaaggaaactgaattcaaa
aagatcaaagtgctgggctctggcgcattcggcacggtgtataagggactctggatccca
gaaggtgagaaagttaaaattcccgtagctatcaaggagttaagagaagcaacgtctcca
aaagccaacaaggaaatcctggatgaggcctacgtgatggccagcgtggacaacccccat
gtgtgccgcctgctgggcatctgcctcacctccactgtgcaactcatcacgcagctcatg
cccttcggctgcctcttggactatgtccgggagcacaaggacaacatcggctcccagtac
ctgctcaactggtgtgtgcagatcgcaaagggcatgaactacctggaggaccgtcgcttg
gtgcaccgcgacctggcagccaggaacgtgctggtgaagacgccgcagcatgtcaagatc
acagattttgggctggccaaactgctgggggcagaagagaaggagtatcatgcggaagga
ggcaaagtgcctatcaagtggatggcgttggaatcaattttacaccgaatttatacccac
cagagtgatgtctggagttacggggtgactgtttgggagttgatgacctttggatccaag
ccatatgatggaatccctgccagcgagatctcctccatcctggagaaaggagagcgcctc
ccccagccacccatatgcaccattgatgtgtacatgatcatggtcaaatgctggatgata
gacgcagatagtcgcccaaagttccgtgagttgatcattgaattctccaaaatggcccga
gacccccagcgctacctggtcattcagggggatgaacgaatgcatttgccaagccctaca
gactccaacttctaccgcgccctgatggatgaagaagacatggacgacgtggtggatgcg
gacgagtacctcatcccacagcagggtttcttcagcagcccctccacgtcgcggactccc
ctcctcagctctctgagcgcaaacagcaacaattccactgtggcttgcattgatagaaac
gggctgcagacctgtcccatcaaggaagacagcttcttacagcgatacagctcagacccc
accggagccttgactgaggacagcatagacgactccttcctcccagtgcctgaatacata
aaccagtgtgttcccaaaaggcctgctggctctgtgcagaatcctgtctatcacaatcag
cccctgaacctcgcgcccagcagggacccacactaccaggacccccacagcaccgcagtg
ggcaaccccgagtatctcaacactgtgcagcccacctgggtcagcagcgcagtggacagc
cctgaccgctggatccagaaagccatccaccaaatcagcctggacaaccctgactaccag
caggacttccttcccaaggaagccaaacccaacggcatgtttaagggccccacagctgaa
aatgcagaatacctaagggtcgcgccacaaagcagtgaatttattggagcgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047979
Entry
101047979         CDS       T04350                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
sbq05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101047979 (IL2RG)
   04151 PI3K-Akt signaling pathway
    101047979 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101047979 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101047979 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101047979 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101047979 (IL2RG)
   04659 Th17 cell differentiation
    101047979 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047979 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101047979 (IL2RG)
   05340 Primary immunodeficiency
    101047979 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047979 (IL2RG)
   05162 Measles
    101047979 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101047979 (IL2RG)
   04090 CD molecules [BR:sbq04090]
    101047979 (IL2RG)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL2 receptor family
   101047979 (IL2RG)
CD molecules [BR:sbq04090]
 Proteins
  101047979 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind DUF508 IL4Ra_N
Other DBs
NCBI-GeneID: 101047979
NCBI-ProteinID: XP_010329217
UniProt: A0A2K6V4R5
LinkDB
Position
Unknown
AA seq 369 aa
MLKPLLPFRSFLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTSMPTDSFSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFADEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTVRKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVGHSHSFSLPSVDGQKRYTFRVRSRFNPLCGSTQHWSEW
SHPIHWGSNTSKENPLLFAVEAVVISIGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGAGASPCNQHSPYWAP
PSYTPKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccattattaccattcagatctttcttattcctgcagctgcccctgctagga
gtggggctgaacacaacgattctgacacccaatgggaatgaagacaccacagctgatttc
ttcctgacctctatgcccactgactccttcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaaccttactctgcactattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctatttgctgacgaaatcacttctggctgtcagctgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccgcgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgattccctgggctccagagaaccta
acagttcgcaaattgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggaacacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtaggtcacagtcatagcttctctctgcctagtgtggatgggcagaaacgctacaca
tttcgtgttcggagccgctttaacccactctgtggaagtactcagcattggagtgaatgg
agccacccgatccattggggtagcaacacttcaaaggagaatcctttactgtttgcagtg
gaagctgtggttatctctattggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacaatgccccgaattcctaccctgaagaacctagaagatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccggactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gccctcggggagggagctggggcctccccatgcaaccagcatagcccctactgggcccca
ccaagttacaccccgaagcctgaaacctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048007
Entry
101048007         CDS       T04350                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048007 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101048007 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101048007 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101048007 (IL20RB)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101048007 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 101048007
NCBI-ProteinID: XP_003931005
UniProt: A0A2K6U5P5
LinkDB
Position
Unknown
AA seq 306 aa
MVLEEVWTSRFMWFVYALIPCLCTGEVAVLPAPQNLSVLSTNMKHLLVWSPVIVPGETVC
YSVEYQGEYESLYMSHIWIPSSWCSLTEGPECDVTDDITATVPYSLRVRATLGSQTSAWS
ILKHPFNRNSTILTPPGMEITKDGLHLVIKLEDLGPQFEFLVAYWRREPGAEERVKMVRS
GSIPVHLETMEPWAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLALALFAFVGFML
ILVVVPLFIWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCGREEVHPCTMAVMSSEEI
FRVWIS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggttctagaagaagtctggacaagtcgtttcatgtggtttgtctatgcattgattcca
tgtttgtgcacaggtgaagtggctgttctgcctgcccctcagaacctctctgtactctca
accaacatgaagcatctcttggtgtggagtccagtgattgtgcctggagaaacagtgtgc
tattctgtcgaataccagggggagtacgagagcctgtacatgagccacatctggatcccc
agcagctggtgctcactcactgaaggtcctgagtgtgacgtcactgatgacatcacggcc
actgtgccatacagccttcgtgtcagggccacactgggctcacagacctcagcctggagc
atcctgaagcatccttttaatagaaattcgaccatccttaccccacctgggatggagatt
accaaggatggcttgcacctggttattaagctggaggacctggggccccagtttgagttc
cttgtggcctactggaggagggagcctggtgccgaggaacgtgtcaaaatggtgaggagt
gggagtattccagtgcacctggaaaccatggagccatgggctgcatactgtgtgaaggcc
cagacattcgtgaaggccattgggaggtacagcgccttcagccagacagagtgtgtggag
gtgcaaggagaggccattcctctggcactggccctgtttgcctttgttggcttcatgctg
attcttgtggttgtgccactgttcatctggaaaatgggccggctgctccagtactcctgt
tgccctgtggtggtcctcccagacaccttgaaaataaccaattcaccccagaagttaatc
agctgcggaagggaagaggtccatccctgtaccatggccgtgatgtcttctgaggaaatc
ttcagggtctggatctcatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048468
Entry
101048468         CDS       T04350                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048468 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101048468 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101048468 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048468 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101048468 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101048468 (IL12RB2)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101048468 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 101048468
NCBI-ProteinID: XP_010346169
UniProt: A0A2K6USS8
LinkDB
Position
Unknown
AA seq 860 aa
MARRGCSLALIFIIMWLLIKAKIDECRRGDVTVTPSRVILLGSTVNISCTLKPRQGCLNA
SRHNKLILYKFDRRINFHHGHSLSSQVTGLPLGTTLFVCKLACINSDEVQICGAEILVGV
APEQPHNVSCIQNGEQGTVACTWDRGRDTHLYTEYTLQLSGPKNLTWQKQCKDHYCDYLD
FGINLTPESPESNFTARVTAVNSLGSSSSFPSTFTFLDIVRPLPPWDIRINFQKASVSRC
TVYWRDEGLVMLNRLRYRPSNSRLWNVVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLCK
GSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSISEARGKILHYEV
TLQELTRGKAVTQNITGHTSWSIVIPRTGSWTVAVSAANSKGSSLPTHINITNLCGAGLL
APLQVSANSEGKDGIRVTWQPPRKAPSAVQEYVVEWRELHPTGDTQVPLNWLRSAPYNVS
ALISENVKPYVCYEIHVYALSGYQGGCSSTLGNSKHEAPLSGPHINAITEEKGSVLISWN
SIPVQEQMGCLLQYRIYWKERDSNSQPQFCEIPYRVSQNSHPINSLQPQVTYVLWMTALT
AAGESSQGNEREICLQGKANWMAFVAPSICIAIIVVGIFSTHYFRQKVFVLLESLRPQWC
SREIPDPANSTCTKKYPIMEEKTQLPLDRLLTDWPTPEDPEPLVISEVLPQATPVFRRPH
GSNWLQRGKGTQGHQTSERDMMPSASSPPPSRALPAERRQLVDLYKVLESRGPDSKPENP
ASPWTVLPAGDLRAQDGYLPSNIDDLPAHEVPLSDSLEELEPQHISLSVFPSSSLHPLTF
SCGDKLTLDQLKMGCDSLML
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggcacgtagaggctgctcattggcactgatttttataatcatgtggctgttgattaaa
gcaaaaatagatgagtgcaggaggggcgatgtgactgtgacgccttcccgtgtaatttta
cttggatccactgtcaatatttcatgcactttgaagcccagacaaggctgtttgaacgct
tccagacataacaagttaatcctgtacaagtttgacagaagaatcaattttcaccatggc
cactccctcagttctcaagtcacaggtcttccccttggtacaaccttgtttgtctgcaaa
ttggcctgtatcaatagtgatgaagttcaaatatgtggagcagagatcttagttggtgtt
gctcccgagcagcctcacaacgtatcctgcatacagaatggagaacaagggactgtggcc
tgcacctgggacagaggacgagacacccacctatacaccgagtacactctacagttaagt
ggaccaaaaaatttaacctggcagaagcaatgtaaagatcattattgtgactatttggac
tttggaatcaacctcacccctgaatcacctgaatccaatttcacagccagggtcactgct
gtcaatagtcttggaagctcctcttcatttccatccacattcactttcttagacatagtg
aggcctcttcctccgtgggacattagaatcaactttcaaaaggcttctgtgagcagatgt
accgtttattggagagatgagggactggtaatgctcaatcgactcagatatcgacccagt
aacagcaggctctggaatgtggttaatgttacaaaggccaaaggaagacatgatttgctg
gatctgaaaccatttacagaatacgaatttcagatttcctctaaactacatctttgcaag
ggaagttggagtgactggagtgaatcattgagagcacaaacaccagaagaagagcctact
gggatgttagatgtctggtacatgaaacggcacattgactacagtagacaacagatttct
cttttctggaagaatctgagcatctcagaggcaagaggaaaaattctccactatgaggtg
accttgcaggagctgacaagagggaaagccgtaacacagaacatcacaggacacacctcc
tggtccatagtcattcctagaaccggaagttggactgtggctgtgtctgcagcaaattca
aaaggcagttctctgcccactcatattaacataacaaacctatgtggggcagggttgctg
gctcctctccaggtctctgcaaactcagagggcaaggacggcattcgggtgacttggcag
cctcccagaaaagctccttctgctgttcaggagtacgtggtggaatggagagagctccat
ccaacgggcgacacacaggtccctctgaactggctgcggagtgccccctacaatgtgtct
gctctgatttcagagaatgtaaaaccctacgtctgttatgaaatccatgtgtatgcactc
tcagggtatcaaggaggatgcagttccaccctgggtaactctaagcacgaagcaccactg
agtggcccccacattaatgccatcacagaggaaaaggggagcgttttaatttcatggaac
agcattccagtccaggaacaaatgggctgcctcctccaatacaggatatattggaaggaa
cgggactccaactcccagccgcagttctgtgaaattccctatagagtttcccaaaattca
catccaataaacagcctgcagccccaagtgacgtatgtcctgtggatgacagctctgaca
gctgctggcgaaagttcccaaggaaatgagagggaaatttgtttgcaaggtaaagccaat
tggatggcgtttgtggcaccaagcatttgcattgctatcatcgtggtgggcattttctcg
acacattacttccggcaaaaggtatttgttctcctagagtccctcagacctcagtggtgt
agcagagaaattccagatccagcaaacagcacttgtactaagaaatatcccatcatggag
gagaagacacagctgcccttggacaggctcctgacagactggcccactcctgaagaccct
gaacccctggtcatcagtgaagtccttcctcaagcgaccccagtcttcagacgtccccat
ggctccaactggctacaaaggggcaaaggaacccaaggtcaccagacctctgagagagac
atgatgcccagtgcctcaagcccaccaccttcaagagctctcccagctgagaggagacaa
ctggtagatctgtacaaggtgctggagagcaggggccctgactcaaagccagaaaacccg
gccagtccctggacggtgctcccggcgggcgaccttcgcgcccaggatggctacctaccc
tccaacatagatgatctccccgcacacgaggtgcctctctctgactccctggaagaactg
gagcctcagcacatctccctttctgtttttccctcaagttctcttcacccactcaccttc
tcctgtggtgataagctgactctggatcagttaaagatggggtgtgactccctcatgctc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049403
Entry
101049403         CDS       T04350                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101049403 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101049403 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101049403 (IL13RA2)
   04090 CD molecules [BR:sbq04090]
    101049403 (IL13RA2)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL3 receptor family
   101049403 (IL13RA2)
CD molecules [BR:sbq04090]
 Proteins
  101049403 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind Il13Ra_Ig
Other DBs
NCBI-GeneID: 101049403
NCBI-ProteinID: XP_010344621
LinkDB
Position
Unknown
AA seq 285 aa
MAFVCLAIGCLYSFLISTTFGYTLSSDTKIEVYPPQDFEIVDPGYLGYLYLQWQPPLSLD
NFKKCTVEYELKYRNIGSETWTTIITKKLHYKDGFDLNKGVEAKIRTLLPRQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGILLDTNYNLFYWYEGLDR
ALQCVDYIKADGQNIGCRFPYLESSDYKDFYICVNGSSEDEPIRSSYFIFQLQNIVKPLP
PSHLTLTRESLCEVQLKWSVPFGPIPARCFIYELEIIEDDTTLVV
NT seq 858 nt   +upstreamnt  +downstreamnt
atggctttcgtttgcttggcaatcggatgcttgtatagctttctgataagcacaacattt
ggctatactttatcttcagacaccaagatagaagtttaccctcctcaggattttgagata
gtggatcctggatatttaggttatctctatttgcaatggcaacccccactgtctctggat
aattttaagaaatgtacagtggaatatgaactaaaataccgaaacatcggtagtgaaaca
tggacgaccatcattactaagaagctacattacaaagatgggtttgatcttaacaagggc
gttgaagcaaagatacgcacacttttaccacggcaatgcacaaacggatcagaagttcaa
agttcctgggcagaaactacttattggatatcaccacaaggaattccggaaactaaagtt
caggatatggattgtgtatattacaattggcaatatttactctgttcttggaaacctggc
ataggtatacttcttgataccaattacaacttgttttactggtatgagggtttagatcgt
gcattacagtgtgttgattacatcaaggctgatggacaaaatattggatgcagatttccc
tatttggagtcatcagactataaagatttctatatttgtgttaatggatcatcagaagac
gagcctatcagatccagttatttcatttttcagcttcaaaatatagttaaacctttgcca
ccaagccatcttactcttactcgggagagtttatgtgaagttcagctgaaatggagcgta
ccttttggacctattccagcaaggtgtttcatttatgaacttgagatcatagaagatgat
actaccttggtggtatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049947
Entry
101049947         CDS       T04350                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101049947 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101049947 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101049947 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049947 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101049947 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101049947 (IL23R)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101049947 (IL23R)
SSDB
Motif
Pfam: fn3 IL12p40_C IL6Ra-bind Lep_receptor_Ig PriX ObR_Ig
Other DBs
NCBI-GeneID: 101049947
NCBI-ProteinID: XP_010346189
UniProt: A0A2K6UES3
LinkDB
Position
Unknown
AA seq 630 aa
MNQVTIQWDVVIALYILFSWCHGGITNINCSGHIWVEPATVFKMGMNISIYCKAAIKNCQ
PRKLHFYKNGIRERSQITRMNKTTARLWYKNFLEPRASMYCTAECTQHFQETLICGKDIS
SGYPPDVPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYVN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSASIISKAETINATVPKTII
YWYSQTTIEKVSCEMRFKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQSWSSPFFHKTPETVPQVTPKSLRHDTWNSGLPVSSISTRRLTSDNRDDIGLLWGM
IVFAVTLSILSLIGILNRSLRTGIKRRILFLIPKWLYEDIPNMKNSNVVKMLQEKSELMN
NNSSEQVLYVDPMITEISEIFIPQHRPADYKKEKNTGPLETRDYLQNSLFDNTTVVYIPD
LNTGYKPQISNFLPGGNLLSSNDEITSLTLKPPFDSLDLGNNPRLKKHPNFAFSVSSVNS
LSHTLFLEELSLILNQGECSPPDIQNSIEEEPTTLLENDSPNETIPEQTLLPDEFVSCLG
ILNEELPSTNSYFPQNILESHFSRISLLEK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatcaggtcaccattcaatgggatgtggtaatagctctttacatactcttcagttgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
gtttttaagatgggtatgaatatctctatatattgcaaagcagcgattaagaactgccaa
ccaaggaaacttcatttttataaaaacggcatcagagaaagatctcaaatcacaaggatg
aacaaaacaacagctcggctttggtataaaaactttctggaaccacgtgcttccatgtac
tgcactgctgaatgtacccaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatgttcctgatgaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggta
catgtgaagagtttagagacagaagaagagcaacaatatctcacctcaagctatgttaac
atctccactgattcattacaaggtggtaagaagtatttggtttgggtccaagcagcaaac
gcactaggcatggaggagtcaaaacagctgcaaattcacctggatgatatagtgatacct
tctgcatccatcatttccaaggctgagactataaatgctacagtgcccaagaccataatt
tactggtatagtcaaacaacaattgaaaaggtttcctgtgaaatgagattcaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcagcagtca
gagttctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagtcttggagttctccattctttcataaaacacctgaaacagttcct
caggtcacaccaaaatcacttcgacatgacacatggaattctggacttccagtttcttcc
atttctacaagacgccttacttctgacaacagagatgacattggacttttatggggaatg
atcgtctttgctgttacattgtcaattctttctttgattgggatacttaacagatcactc
agaactggaattaaaagacgaatcttatttttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaaaagtgaacttatgaat
aataattccagcgaacaggtcctgtatgttgatcccatgattacagagataagcgaaatc
tttatcccacaacacaggcctgcagactacaagaaggaaaagaatacaggacccctggag
acaagagactacctccaaaactcgctattcgacaatactacagttgtgtatattcctgat
ctcaacactggatataaaccccaaatttcaaattttctgcctggaggaaaccttctcagc
agtaatgatgaaatcacttccttaacacttaaaccaccatttgattccttagacttagga
aataatcccaggttaaaaaagcatcctaattttgctttttctgtctcaagtgtgaattca
ctgagccacacactatttcttgaagaattaagcctcatattaaatcaaggagaatgcagt
cctcctgacatacaaaactcaatagaggaggaacccaccacgcttttggaaaatgattca
cccaatgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttgggg
atcctgaatgaggagttgccatctactaattcttattttccacaaaacattttggaaagc
cacttcagcaggatttcactcttggaaaagtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050965
Entry
101050965         CDS       T04350                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04066  HIF-1 signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05200  Pathways in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101050965 (IFNGR2)
   04066 HIF-1 signaling pathway
    101050965 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101050965 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101050965 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101050965 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    101050965 (IFNGR2)
   04659 Th17 cell differentiation
    101050965 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101050965 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050965 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101050965 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101050965 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101050965 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    101050965 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    101050965 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101050965 (IFNGR2)
   05140 Leishmaniasis
    101050965 (IFNGR2)
   05142 Chagas disease
    101050965 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101050965 (IFNGR2)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IFN receptor family
   101050965 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 101050965
NCBI-ProteinID: XP_003927804
LinkDB
Position
Unknown
AA seq 299 aa
MLVRQNVGISESHTGHLNSCPPQDSLSQLPAPQHPRIRLYNEEQVLSWEPVTLSNGTRPV
VYRVQFKYQSSKTKITWSTLWENLKSESRVADSGCRLFGSQLTVGPPENIEVTPGEGSLI
IRFSSPFDIPHTSTAYFWYYVYYWEEAGVQKVKGPFRSNSISLGNLKPFRVYCLQVQAQL
LWNKSNVNGHLSNTSCYRIMADASTKLQQVILISVGAFSLMLVLAGACFFLVLKYRGLIK
YWFHTPPSIPLQIEEYLKDPAQPILDALDKDSSPKDDVWDSVSIILFPEKEQEDVLQTH
NT seq 900 nt   +upstreamnt  +downstreamnt
atgttggtgcgccagaatgtagggatcagcgagtcccacactgggcacctgaacagctgt
ccccctcaagactctctttcccagctgcccgctcctcagcacccgaggattcgtctgtac
aacgaagaacaggtcctgagttgggagccagtgaccctgagcaatggcacgaggcctgtg
gtctaccgggtgcagtttaaatatcagagtagcaagaccaaaattacatggagcacttta
tgggagaatttgaagtctgaatcacgggtagcagacagtggctgcaggctatttggttcc
cagttgactgtcgggcctccagaaaacatcgaggtgaccccaggagaaggctccctcatc
atcaggttctcctctccctttgacatccctcatacctccacagcctatttttggtactat
gtctattactgggaagaagctggagtccaaaaggtcaaaggccctttcagaagcaactcc
atttcattgggtaacttaaaacccttcagagtatactgtttacaagtccaggcacaactg
ctttggaacaaaagtaacgtaaacgggcacttaagcaacacatcttgctacagaatcatg
gcagatgcctccaccaagcttcagcaagtcatcctgatctctgtgggagcattttcgttg
atgttggtgctggcaggggcctgtttcttcctggtcctgaaatacagaggcctgattaaa
tactggtttcacactccaccaagcatcccgttacagatagaagagtatttaaaggaccct
gctcagcccattttggatgccttggacaaggacagctcaccaaaggatgacgtctgggac
tctgtgtccatcattttgtttccagaaaaggagcaagaagatgttctccaaacacattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053121
Entry
101053121         CDS       T04350                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053121 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101053121 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101053121 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101053121 (IL20RA)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL10/28 receptor family
   101053121 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101053121
NCBI-ProteinID: XP_003932524
UniProt: A0A2K6UAY8
LinkDB
Position
Unknown
AA seq 504 aa
MKNVLQWNQPEDLQGVKVTYTVQYFIYGQKKWLNKSECRNISRTYCDLSAETSDYEHQYY
AKVKAMWGTECSKWAESGRFYPFLETQIGPPEVALKVGDKSISVVLTAPEKWKRNPEDIP
ISMQQIYSNLKYNVSVSNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRA
QPSEKQCARTLKDQSSEFKAKIIFWYVLPVSVTVFLFSVMGYSVYRYIHVGEEKHPANLI
LIYGNEFDKRFFVPAEKVVINFITLSISEDSKISHQDTSLLGKSSDASSLNNPQRSRNLE
PPQEEEEVKHLGYASHLMEFFCDSEGNSEGTSLTQEESISRTISPDKTVIEYEYDVRTTD
ICAGPEEQELSLQEEVSRQGRLFDSQAALAVLGLQTLQYSYSPQLRDLDPLAWGHTDSEE
GPEEEPSTTLVDWDPQTGRLCIPSLSSFDQDSEGCEPSEGNGLWEEGLLSRLYEALAPDR
PPGENETYLMQFMEEWGLSVQMES
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaagaatgtcctgcaatggaatcaaccagaggatcttcaaggagttaaagttacttac
actgtgcagtatttcatatatgggcaaaagaaatggctgaataaatcagaatgcagaaat
atcagtaggacctactgtgatctttctgctgaaacttctgactacgaacaccagtattat
gccaaagttaaggccatgtgggggacagagtgttccaaatgggctgagagtggacggttc
tatccttttttagaaacacaaattggcccaccggaggtggccctgaaggtgggtgataag
tccatttctgttgtcctgacggctccagagaagtggaagagaaatccagaagacattcct
atttccatgcaacaaatatactccaatctgaagtataatgtgtctgtgtcgaacactaaa
tcaaatagaacgtggtcccagtgtgtgaccaaccacacgctggtgctcacctggctggag
ccgaacacactgtactgcgtccacgtggagtcctttgtcccagggccccctcgccgtgct
cagccttctgagaagcagtgtgccaggactttgaaagatcaatcatcagagttcaaggct
aaaatcattttctggtatgttttgcccgtatctgttaccgtgtttcttttttctgtgatg
ggctattccgtctaccgatatatccacgttggcgaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtgcctgctgaaaaagtcgtgatt
aactttatcaccctcagtatctcggaggattctaaaatttctcatcaggatacaagtttg
ctgggaaaaagcagtgatgcatccagccttaataatcctcagcgtagcaggaacctggag
ccccctcaagaggaagaggaggtgaaacatttaggatatgcttcgcatttgatggaattt
ttttgtgactctgaaggaaactcggaaggtacttccctcacccaggaagagtccatcagc
agaacaatatccccagataaaacagtcatcgaatatgaatatgatgtaagaaccactgac
atctgtgcagggcctgaagagcaggagctcagtttgcaagaggaggtgtccaggcaagga
agattatttgactcacaggcagcactggcagtcttgggtctgcaaacattacagtactca
tacagccctcagctccgagacttagaccctctggcatgggggcacacagattcggaggag
ggtccagaggaagagccatcgacaaccctggttgactgggacccccaaactggcaggctg
tgtatcccttcattgtctagctttgaccaggactcagagggctgcgagccttcagagggg
aatgggctctgggaggagggccttctatctagactctatgaggcgctggctccagacagg
ccgccaggagaaaatgaaacctatctcatgcaattcatggaggaatgggggttatctgta
cagatggaaagctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054160
Entry
101054160         CDS       T04350                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1 isoform X1
  KO
K05132  interferon gamma receptor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04066  HIF-1 signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05200  Pathways in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101054160 (IFNGR1)
   04066 HIF-1 signaling pathway
    101054160 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101054160 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101054160 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101054160 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    101054160 (IFNGR1)
   04659 Th17 cell differentiation
    101054160 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101054160 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101054160 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101054160 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101054160 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101054160 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    101054160 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    101054160 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101054160 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101054160 (IFNGR1)
   05140 Leishmaniasis
    101054160 (IFNGR1)
   05142 Chagas disease
    101054160 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101054160 (IFNGR1)
   04090 CD molecules [BR:sbq04090]
    101054160 (IFNGR1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IFN receptor family
   101054160 (IFNGR1)
CD molecules [BR:sbq04090]
 Proteins
  101054160 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Pox_EPC_I2-L1
Other DBs
NCBI-GeneID: 101054160
NCBI-ProteinID: XP_010335866
LinkDB
Position
Unknown
AA seq 484 aa
MALLVLLTLAMQGVSRAEMGTADPGPSSVPIPTNVTIESYNMKPVVYWEYQIMPQVPVFT
VEVKTYGYGDWIVACTNISHRYCKISDHVNDPLNSLWVRVKARVGQKESAYAKSEEFTVC
QHGKIEPPKLSIRKEEKQITIDIFHPSVFVNGEEQEVDYYDEITCYIIVYNVYVRVNGSE
IPYKVSTKMEDDCNEIQCQLTVPVPSLNSQYCVSAEGVLNVWGVTTEKSKEVCVTISNSS
IKGSLWIPAVAVLLFLVVAAVLIYFYIKKINPLKEKSIILPKSLISVVRSATTETKPESK
YMSRITSYQPFFLEKEVDCEEALSPVPDMHTEDNPEKGEHTEELSSITEVVTTEEDIPDM
VPGSHLTPIERESSSLLSSNQSEPGSVTLNSYHSRNCSDGEHSRNGCDTESSCLESHSSL
SDSEFPPNNKAQIKTEEQELITVIKAPTSFGYDKPHVLVDLLVDDDGKESLIGYRPTKDS
REFS
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggctcttctcgttctcctgacccttgccatgcagggtgtgagcagggctgagatgggc
accgcggatccagggccgtcctcagtacctataccaactaatgttacaattgagtcctat
aacatgaaacctgtcgtgtattgggagtaccagatcatgccacaggttcctgtttttacc
gtagaggtaaagacctatggttacggagactggattgttgcctgcaccaatatttctcat
cgttattgtaagatttctgaccacgttaatgatccattaaattcactttgggtcagagtt
aaagctagagttggacaaaaagaatctgcctatgcaaagtcagaagaatttaccgtatgc
caacatggaaaaattgaaccacctaaactgagtatcagaaaggaagagaagcaaatcaca
attgacatatttcacccttcagtttttgtaaatggagaagagcaggaagtggattattat
gatgaaattacctgttacattattgtgtacaatgtctatgtgagagtgaacggaagtgag
atcccgtataaagtatccacaaagatggaagacgattgcaacgagattcagtgccagtta
acagttccagtgccctcactgaattcccagtactgtgtttcggcagaaggagtcttaaat
gtatggggtgttacaactgaaaagtcaaaagaagtttgtgttaccatttccaatagcagc
ataaaaggttctctttggattccggctgtggctgttttactatttctagtagttgctgcg
gtattgatctatttttatattaagaagattaatccattgaaggaaaaaagcataatatta
cccaagtccttgatctctgtggtaagaagtgccactacagagacaaaacctgaatcaaaa
tacatgtcacgcattacatcataccagccatttttcttagaaaaggaggtggactgtgaa
gaggcattgtctccagttccagacatgcataccgaagacaatccagaaaaaggagaacat
acagaagaactttctagcataaccgaagtggtgactactgaagaagacattcctgacatg
gtcccgggcagccatctgactccaatagagagagagagttcttcacttttaagtagtaac
caatctgaacccggcagcgtcactttaaactcatatcactccagaaattgttctgatggt
gagcactccagaaatggttgtgatactgaatccagctgtctggaatctcatagctcctta
tctgactcagaatttcccccaaataataaagctcaaataaaaacagaagaacaagagctc
ataacagtaataaaagcccccacttccttcggttatgataaaccacatgtgctggtggat
ctacttgtcgatgatgatggtaaagagtccttgattggatatagaccaacaaaagattcc
agagaattttcatga

DBGET integrated database retrieval system