KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027719
Entry
101027719         CDS       T04350                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00020  Citrate cycle (TCA cycle)
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04910  Insulin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
sbq04964  Proximal tubule bicarbonate reclamation
Module
sbq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101027719 (PCK2)
   00020 Citrate cycle (TCA cycle)
    101027719 (PCK2)
   00620 Pyruvate metabolism
    101027719 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101027719 (PCK2)
   04151 PI3K-Akt signaling pathway
    101027719 (PCK2)
   04152 AMPK signaling pathway
    101027719 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101027719 (PCK2)
   04922 Glucagon signaling pathway
    101027719 (PCK2)
   04920 Adipocytokine signaling pathway
    101027719 (PCK2)
   03320 PPAR signaling pathway
    101027719 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101027719 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101027719 (PCK2)
Enzymes [BR:sbq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     101027719 (PCK2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 101027719
NCBI-ProteinID: XP_003924343
UniProt: A0A2K6UP01
LinkDB
Position
Unknown
AA seq 640 aa
MAALYRPGLRHSWHGLSPLGWPLCRSIQTLRVLSGDLGQLPAGVRDFVERSARLCQPEGI
HICDGTEAENTATLTLLEQHGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLSPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS
ESTAAAEHKGKIIMHDPFAMRPFFGYNFGRYLEHWLSMEGRKGARLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLGAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVYKM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggccgctttgtaccgccccggcctgcggcatagctggcatgggctgagccccttgggc
tggccattatgccgtagcatccagaccctgcgagtacttagtggagatctgggccagctt
cctgccggtgttcgagattttgtagaacgcagtgcccgcctgtgccaaccagagggcatc
cacatctgtgatggaactgaggctgagaatactgccacactgaccctgctggagcagcac
ggcctcatccgaaagctccccaagtacaataactgctggctggcccgcacagaccccaag
gacgtggcgcgagtagagagcaagacggtgattgtaactccttctcagcgggacacagta
cctctcccagctggtggggcccgtgggcagctgggcaactggatgtccccagctgatttc
cagcgagctgtggatgagaggtttccaggctgcatgcagggccgcaccatgtatgtgctt
ccattcagcatgggtcctgtgggctccccactgtcccgcatcggggtacagctcactgac
tcagcctatgtagtggcaagcatgcgtattatgacccgactggggacacctgtgcttcag
gccctgggagatggtgactttgtcaagtgtctgcactctgtgggccagcccctgacagga
caaggggagccagtgagccagtggccgtgcaacccagagaaaaccctgattggccacgtg
cccgaccagcgggagatcgtctccttcggcagcggctatggtggcaactccctgctgggc
aagaagtgctttgccctgcgcatcgcctctcggctggcccgggatgaaggctggctggca
gagcacatgctgatcctgggcatcaccaaccctgcagggaagaagcgctatgtggcagct
gccttccccagtgcctgtggcaagaccaacctggccatgatgcggccagcactgccaggc
tggaaagtggagtgtgtgggggatgacattgcttggatgaggtttgacagtgaaggtcga
ctccgggccatcaaccctgagaacggcttctttggggttgcccctggtacttctgctacc
accaatcccaacgccatggctacaatccagagtaacactctttttaccaatgtggctgag
accagcgatggtggcgtgtactgggaaggcatcgaccagcctctttcacctggtgttact
gtgacctcctggctgggcaaaccctggaaacctggtgacaaggagccctgtgcacatccc
aactctcgattttgtgccccagctcgccagtgccccatcatggacccagcctgggaggcc
ccagagggtgtccccattgatgctatcatctttggtggacgcagacccaaaggggtaccc
ctggtatacgaggccttcaactggcgtcatggggtgtttgtgggcagtgccatgcgctct
gagtccactgctgcagcagaacacaaagggaagatcatcatgcacgacccatttgccatg
cggcccttttttggctacaacttcgggcgctacctggaacactggctgagcatggagggt
cgcaagggggcccggctgcctcgtatcttccatgtcaactggttccggcgtgacgaggca
ggccgcttcctgtggccaggctttggggagaatgctcgggtgctagactggatatgccgg
cggttagaaggggaggacagtgcccaagagacacccatcgggctggtgccaaaggaagga
gccttggatctcagtggcctcggagctatagacaccactcagctgttctccctccccaag
gacttctgggaacaggaggttcgtgacattcggagctacctgacagagcaggtcaaccag
gatctgcccaaagaggtgttggctgaacttgaggccctagagagacgtgtgtacaaaatg
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035593
Entry
101035593         CDS       T04350                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP] isoform X2
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00020  Citrate cycle (TCA cycle)
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04910  Insulin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
sbq04964  Proximal tubule bicarbonate reclamation
Module
sbq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101035593 (PCK1)
   00020 Citrate cycle (TCA cycle)
    101035593 (PCK1)
   00620 Pyruvate metabolism
    101035593 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101035593 (PCK1)
   04151 PI3K-Akt signaling pathway
    101035593 (PCK1)
   04152 AMPK signaling pathway
    101035593 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101035593 (PCK1)
   04922 Glucagon signaling pathway
    101035593 (PCK1)
   04920 Adipocytokine signaling pathway
    101035593 (PCK1)
   03320 PPAR signaling pathway
    101035593 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101035593 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101035593 (PCK1)
Enzymes [BR:sbq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     101035593 (PCK1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 101035593
NCBI-ProteinID: XP_003932668
UniProt: A0A2K6SKS0
LinkDB
Position
Unknown
AA seq 622 aa
MPPQLQNGLDIAAKVVQGTLDSLPQAVREFIENNAELCQPDRIHICDGSEEENTQLLGYM
EEQGTLRRLKKYDSCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEQLAPGVTITSWKNKAWSPQDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRVDGKAGAKLTPIGYIPKEDALNLKGLGHVNTMELFSISKEFWEKEVEEIEKYLEEQV
NADLPCEIEREVLALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagctgcaaaacggcctggacatcgcagccaaagttgtccagggcaccctg
gacagcctaccccaggcggtgagggagtttatcgagaacaacgctgagctgtgtcagccc
gatcgcatccacatctgcgatggctccgaggaggagaatacacagcttctgggctacatg
gaggagcagggcaccctcaggcggctgaagaaatatgacagctgctggttagctctcact
gaccccagggatgtggccaggatcgaaagcaagacggttatcatcacccaagagcaaaga
gacacagtgcccatccccaaaactggcctcagccagctcggtcgctggatgtcagaggag
gattttgagaaagcattcaatgccagattcccagggtgcatgaaaggtcgcaccatgtat
gtcatcccattcagcatggggccgctgggctcgcctctgtcaaagatcggcattgagctg
acggattcgccctatgtggtggccagcatgaggatcatgacgcggatgggcacgcctgtc
ctggaagcactgggcgatggggagtttgttaaatgcctccattctgtggggtgccctctg
cctttaaaaaagcctttggtcaataactgggcctgcaacccggagctgactctcatcgcg
cacctgcctgatcgcagagagatcatctccttcggaagtgggtacggcgggaactcgctg
ctcgggaaaaagtgctttgctctcaggatggccagccggctagccaaagaggaaggctgg
ctggcagagcacatgctgatcctgggtataaccaaccccgagggcaagaagaagtacctg
gcggctgcatttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaaggttgagtgtgtcggggacgatatcgcctggatgaagtttgatgcgcaa
ggtaatttaagggctatcaacccagaaaatggcttttttggggttgctcctgggacctct
gtgaagaccaaccccaatgccatcaagacaatccagaagaacactatcttcaccaatgtg
gctgagactagcgacgggggcgtttactgggaaggtattgatgagcagctagctccagga
gtcaccatcacttcctggaagaataaggcgtggagcccacaggatggggaaccttgtgcc
caccccaactcgagattctgcacccctgccagccagtgccccatcatcgatgccgcctgg
gagtctccagaaggcgttcccattgaaggcatcatctttggaggccgcagacctgctggt
gtccctctagtctatgaagctctcagctggcaacatggagtcttcgtgggggcggccatg
agatcagaggccacagcagctgcagagcataaaggcaaaatcatcatgcacgaccccttt
gccatgcggcccttctttggctataactttggtaaatatctggcccactggcttagcatg
gcccagcacccagcagccaagctgcccaagatcttccatgtcaactggttccggaaggac
aaggaaggcaaattcctctggccaggctttggagagaactccagggtgctggagtggatg
ttcaaccgggtggacgggaaagccggcgccaagctcacgcccataggctacatccccaag
gaggatgccctgaacctgaaaggcctggggcacgtcaacacaatggagctcttcagcatc
tccaaggagttctgggagaaggaggtggaagaaatcgagaagtatctggaggagcaagtc
aacgcggatctcccctgtgagattgagagagaggttctcgccttgaagcaaagaataagc
cagatgtaa

DBGET integrated database retrieval system