KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027742
Entry
101027742         CDS       T04350                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X4
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04024  cAMP signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04141  Protein processing in endoplasmic reticulum
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04310  Wnt signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04530  Tight junction
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04926  Relaxin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05231  Choline metabolism in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101027742 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101027742 (MAPK9)
   04012 ErbB signaling pathway
    101027742 (MAPK9)
   04014 Ras signaling pathway
    101027742 (MAPK9)
   04310 Wnt signaling pathway
    101027742 (MAPK9)
   04668 TNF signaling pathway
    101027742 (MAPK9)
   04068 FoxO signaling pathway
    101027742 (MAPK9)
   04071 Sphingolipid signaling pathway
    101027742 (MAPK9)
   04024 cAMP signaling pathway
    101027742 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101027742 (MAPK9)
   04137 Mitophagy - animal
    101027742 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    101027742 (MAPK9)
   04215 Apoptosis - multiple species
    101027742 (MAPK9)
   04217 Necroptosis
    101027742 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101027742 (MAPK9)
   04530 Tight junction
    101027742 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101027742 (MAPK9)
   04621 NOD-like receptor signaling pathway
    101027742 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    101027742 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    101027742 (MAPK9)
   04660 T cell receptor signaling pathway
    101027742 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    101027742 (MAPK9)
   04659 Th17 cell differentiation
    101027742 (MAPK9)
   04657 IL-17 signaling pathway
    101027742 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    101027742 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101027742 (MAPK9)
   04920 Adipocytokine signaling pathway
    101027742 (MAPK9)
   04912 GnRH signaling pathway
    101027742 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    101027742 (MAPK9)
   04917 Prolactin signaling pathway
    101027742 (MAPK9)
   04926 Relaxin signaling pathway
    101027742 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    101027742 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    101027742 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    101027742 (MAPK9)
   04722 Neurotrophin signaling pathway
    101027742 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101027742 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101027742 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101027742 (MAPK9)
   05231 Choline metabolism in cancer
    101027742 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101027742 (MAPK9)
   05212 Pancreatic cancer
    101027742 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101027742 (MAPK9)
   05012 Parkinson disease
    101027742 (MAPK9)
   05016 Huntington disease
    101027742 (MAPK9)
   05017 Spinocerebellar ataxia
    101027742 (MAPK9)
   05020 Prion disease
    101027742 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    101027742 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101027742 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101027742 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    101027742 (MAPK9)
   04931 Insulin resistance
    101027742 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101027742 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101027742 (MAPK9)
   05135 Yersinia infection
    101027742 (MAPK9)
   05133 Pertussis
    101027742 (MAPK9)
   05152 Tuberculosis
    101027742 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101027742 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    101027742 (MAPK9)
   05161 Hepatitis B
    101027742 (MAPK9)
   05171 Coronavirus disease - COVID-19
    101027742 (MAPK9)
   05162 Measles
    101027742 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101027742 (MAPK9)
   05169 Epstein-Barr virus infection
    101027742 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101027742 (MAPK9)
   05142 Chagas disease
    101027742 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101027742 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101027742 (MAPK9)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101027742 (MAPK9)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101027742 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 101027742
NCBI-ProteinID: XP_003943995
LinkDB
Position
Unknown
AA seq 382 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKSIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQTSAQMQQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagattcaactttc
accgtcctaaaacgttaccagcagctgaaatcgattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcacaaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggatcatgaaagaatgtcctatcttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcacggacagcatgcactaacttt
atgatgactccttatgtggtgacgcggtactaccgagcacctgaagtcatcctgggtatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatatcgatcagtggaataaagttattgagcag
cttggaacaccatcagcagagttcatgaagaaacttcagccaactgtgagaaattatgta
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcggaatctgaacgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgatcctgctgaagcagaagcaccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctgatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagacttcagcacagatg
cagcagtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039160
Entry
101039160         CDS       T04350                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04024  cAMP signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04141  Protein processing in endoplasmic reticulum
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04310  Wnt signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04530  Tight junction
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04926  Relaxin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05231  Choline metabolism in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101039160 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101039160 (MAPK8)
   04012 ErbB signaling pathway
    101039160 (MAPK8)
   04014 Ras signaling pathway
    101039160 (MAPK8)
   04310 Wnt signaling pathway
    101039160 (MAPK8)
   04668 TNF signaling pathway
    101039160 (MAPK8)
   04068 FoxO signaling pathway
    101039160 (MAPK8)
   04071 Sphingolipid signaling pathway
    101039160 (MAPK8)
   04024 cAMP signaling pathway
    101039160 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101039160 (MAPK8)
   04137 Mitophagy - animal
    101039160 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    101039160 (MAPK8)
   04215 Apoptosis - multiple species
    101039160 (MAPK8)
   04217 Necroptosis
    101039160 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101039160 (MAPK8)
   04530 Tight junction
    101039160 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101039160 (MAPK8)
   04621 NOD-like receptor signaling pathway
    101039160 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    101039160 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    101039160 (MAPK8)
   04660 T cell receptor signaling pathway
    101039160 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    101039160 (MAPK8)
   04659 Th17 cell differentiation
    101039160 (MAPK8)
   04657 IL-17 signaling pathway
    101039160 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    101039160 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101039160 (MAPK8)
   04920 Adipocytokine signaling pathway
    101039160 (MAPK8)
   04912 GnRH signaling pathway
    101039160 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    101039160 (MAPK8)
   04917 Prolactin signaling pathway
    101039160 (MAPK8)
   04926 Relaxin signaling pathway
    101039160 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    101039160 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    101039160 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    101039160 (MAPK8)
   04722 Neurotrophin signaling pathway
    101039160 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101039160 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101039160 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039160 (MAPK8)
   05231 Choline metabolism in cancer
    101039160 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101039160 (MAPK8)
   05212 Pancreatic cancer
    101039160 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101039160 (MAPK8)
   05012 Parkinson disease
    101039160 (MAPK8)
   05016 Huntington disease
    101039160 (MAPK8)
   05017 Spinocerebellar ataxia
    101039160 (MAPK8)
   05020 Prion disease
    101039160 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    101039160 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101039160 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101039160 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    101039160 (MAPK8)
   04931 Insulin resistance
    101039160 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101039160 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101039160 (MAPK8)
   05135 Yersinia infection
    101039160 (MAPK8)
   05133 Pertussis
    101039160 (MAPK8)
   05152 Tuberculosis
    101039160 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101039160 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    101039160 (MAPK8)
   05161 Hepatitis B
    101039160 (MAPK8)
   05171 Coronavirus disease - COVID-19
    101039160 (MAPK8)
   05162 Measles
    101039160 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101039160 (MAPK8)
   05169 Epstein-Barr virus infection
    101039160 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101039160 (MAPK8)
   05142 Chagas disease
    101039160 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101039160 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101039160 (MAPK8)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101039160 (MAPK8)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101039160 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101039160
NCBI-ProteinID: XP_003930025
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagtcgacca
tttcagaatcaaactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtaaaa
tctgactgcactttgaagattcttgactttggtctggccaggactgcaggaacaagtttt
atgatgacgccttatgtagtgactcgctactacagagcacctgaggtcatcctcggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcaatggaataaagttattgaacag
cttggaacaccgtgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctgggtatagcttcgagaaactcttccctgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccagcacccatac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
caattagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggaaagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtccgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048066
Entry
101048066         CDS       T04350                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04024  cAMP signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04141  Protein processing in endoplasmic reticulum
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04310  Wnt signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04530  Tight junction
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04926  Relaxin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05231  Choline metabolism in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101048066 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101048066 (MAPK10)
   04012 ErbB signaling pathway
    101048066 (MAPK10)
   04014 Ras signaling pathway
    101048066 (MAPK10)
   04310 Wnt signaling pathway
    101048066 (MAPK10)
   04668 TNF signaling pathway
    101048066 (MAPK10)
   04068 FoxO signaling pathway
    101048066 (MAPK10)
   04071 Sphingolipid signaling pathway
    101048066 (MAPK10)
   04024 cAMP signaling pathway
    101048066 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101048066 (MAPK10)
   04137 Mitophagy - animal
    101048066 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    101048066 (MAPK10)
   04215 Apoptosis - multiple species
    101048066 (MAPK10)
   04217 Necroptosis
    101048066 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101048066 (MAPK10)
   04530 Tight junction
    101048066 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101048066 (MAPK10)
   04621 NOD-like receptor signaling pathway
    101048066 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    101048066 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    101048066 (MAPK10)
   04660 T cell receptor signaling pathway
    101048066 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    101048066 (MAPK10)
   04659 Th17 cell differentiation
    101048066 (MAPK10)
   04657 IL-17 signaling pathway
    101048066 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    101048066 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101048066 (MAPK10)
   04920 Adipocytokine signaling pathway
    101048066 (MAPK10)
   04912 GnRH signaling pathway
    101048066 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    101048066 (MAPK10)
   04917 Prolactin signaling pathway
    101048066 (MAPK10)
   04926 Relaxin signaling pathway
    101048066 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    101048066 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    101048066 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    101048066 (MAPK10)
   04722 Neurotrophin signaling pathway
    101048066 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101048066 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101048066 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048066 (MAPK10)
   05231 Choline metabolism in cancer
    101048066 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101048066 (MAPK10)
   05212 Pancreatic cancer
    101048066 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101048066 (MAPK10)
   05012 Parkinson disease
    101048066 (MAPK10)
   05016 Huntington disease
    101048066 (MAPK10)
   05017 Spinocerebellar ataxia
    101048066 (MAPK10)
   05020 Prion disease
    101048066 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    101048066 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101048066 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101048066 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    101048066 (MAPK10)
   04931 Insulin resistance
    101048066 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101048066 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101048066 (MAPK10)
   05135 Yersinia infection
    101048066 (MAPK10)
   05133 Pertussis
    101048066 (MAPK10)
   05152 Tuberculosis
    101048066 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101048066 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    101048066 (MAPK10)
   05161 Hepatitis B
    101048066 (MAPK10)
   05171 Coronavirus disease - COVID-19
    101048066 (MAPK10)
   05162 Measles
    101048066 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101048066 (MAPK10)
   05169 Epstein-Barr virus infection
    101048066 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101048066 (MAPK10)
   05142 Chagas disease
    101048066 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101048066 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101048066 (MAPK10)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101048066 (MAPK10)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101048066 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101048066
NCBI-ProteinID: XP_003924027
UniProt: A0A2K6U2B1
LinkDB
Position
Unknown
AA seq 464 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggagctcagggcatagtttgtgct
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcataccgggagctggtcctcatgaagtgtgtgaaccat
aaaaatatcattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttatttagtaatggaactgatggatgccaacttatgtcaagtgatccagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgcggcattaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccgtatgtggtgacacgttattacagagcccccgaagtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaat
gtctggtatgacccagctgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacatacaattgaagaatggaaagaacttatctacaaggaagtaatgaac
tcggaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system