KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027825
Entry
101027825         CDS       T04350                                 

Gene name
PTPN2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X3
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101027825 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101027825 (PTPN2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101027825 (PTPN2)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101027825 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 Y_phosphatase3 IKKbetaNEMObind
Other DBs
NCBI-GeneID: 101027825
NCBI-ProteinID: XP_003924918
UniProt: A0A2K6TW87
LinkDB
Position
Unknown
AA seq 387 aa
MPTTIEQEFEELDAHRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDMEEAQRSYILTQGPLPNTCCHFWLMVWQQKSKAVVMLNRTVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENTNSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKQWKELSKEDLSPA
FDHSPNKITTEKYNGNRIGREEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRPRLTDT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgcccaccaccatcgagcaggagtttgaggagttggatgctcatcgtcgctggcagcca
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcagaatgctgagaatgattatattaatgccagcttagttgacatggaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagtccaaagcagttgtcatgctgaatcgcacagtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaataccaatagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccccgaccacgggcctgcggtgatccactgtagtgcaggcatt
gggcgctctggcaccttctctctggtagacacttgtcttgttttgatggaaaaaggagat
gatattaacattaaacaagtgttattgaacatgagaaaataccgaatgggtcttattcaa
acccctgatcaactgagattctcatacatggctataatagaaggagcaaaatgtataaag
ggagattctagtatacagaaacagtggaaagaactttctaaggaagacttatctcctgct
tttgatcattcaccaaacaaaataacgactgaaaaatacaatggaaacagaataggtcga
gaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatgcaagataca
atggaggagaacagtgagagtgctctacggaagcgtattcgagaggacagaaaggccacc
acagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaagaaaa
aggccaagattgacagacacctaa

DBGET integrated database retrieval system