KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027903
Entry
101027903         CDS       T04350                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X2
  KO
K10140  DNA damage-binding protein 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03420  Nucleotide excision repair
sbq04115  p53 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05161  Hepatitis B
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101027903 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    101027903 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101027903 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101027903 (DDB2)
   05202 Transcriptional misregulation in cancer
    101027903 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101027903 (DDB2)
   05212 Pancreatic cancer
    101027903 (DDB2)
   05225 Hepatocellular carcinoma
    101027903 (DDB2)
   05226 Gastric cancer
    101027903 (DDB2)
   05214 Glioma
    101027903 (DDB2)
   05216 Thyroid cancer
    101027903 (DDB2)
   05220 Chronic myeloid leukemia
    101027903 (DDB2)
   05217 Basal cell carcinoma
    101027903 (DDB2)
   05218 Melanoma
    101027903 (DDB2)
   05213 Endometrial cancer
    101027903 (DDB2)
   05224 Breast cancer
    101027903 (DDB2)
   05222 Small cell lung cancer
    101027903 (DDB2)
   05223 Non-small cell lung cancer
    101027903 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101027903 (DDB2)
   05169 Epstein-Barr virus infection
    101027903 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101027903 (DDB2)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101027903 (DDB2)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     101027903 (DDB2)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101027903 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 101027903
NCBI-ProteinID: XP_003920111
UniProt: A0A2K6UAZ3
LinkDB
Position
Unknown
AA seq 427 aa
MAPKKRPETKKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRCDSDCLWAGLAGP
QILPPCRSIVRTLHQHRLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRIYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHVLIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaaccaagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggcggggctggctggccca
cagatcctgccaccatgccgcagcatagtcaggaccctccaccagcataggctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaagccgccccctttgacaggagggctacatccttggcatggcac
ccgactcaccccagcaccgtggctgtgggttccaaaggtggagatatcttgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtctttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgccagcagccgaatggtggtcacaggagac
aatgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccacacaggcatcctgtcaatgcagcttgtttcagtccggatgga
gcccggctcctgaccacggaccagaagagcgagatccgaatttactctgcctcccagtgg
gactgccccctgggtctcatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctataacctcattgtcgtcggccgatacccagatcctaat
ttcaagagttgtactccctatgaattgaggacaatcgatgtgttcgatggaaactcaggg
aagatgatgtgtcagctctacgacccagaatcttctggcattagttcgctcaatgagttc
aatcctatgggggacacgctggcctctgcaatgggttaccacgttctcatttggagccag
gaggaagccaggacacggaaatga

DBGET integrated database retrieval system