KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101027982
Entry
101027982         CDS       T04350                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101027982 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101027982 (PIK3CB)
   04014 Ras signaling pathway
    101027982 (PIK3CB)
   04015 Rap1 signaling pathway
    101027982 (PIK3CB)
   04370 VEGF signaling pathway
    101027982 (PIK3CB)
   04630 JAK-STAT signaling pathway
    101027982 (PIK3CB)
   04668 TNF signaling pathway
    101027982 (PIK3CB)
   04066 HIF-1 signaling pathway
    101027982 (PIK3CB)
   04068 FoxO signaling pathway
    101027982 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101027982 (PIK3CB)
   04072 Phospholipase D signaling pathway
    101027982 (PIK3CB)
   04071 Sphingolipid signaling pathway
    101027982 (PIK3CB)
   04024 cAMP signaling pathway
    101027982 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    101027982 (PIK3CB)
   04152 AMPK signaling pathway
    101027982 (PIK3CB)
   04150 mTOR signaling pathway
    101027982 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101027982 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    101027982 (PIK3CB)
   04218 Cellular senescence
    101027982 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101027982 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    101027982 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101027982 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101027982 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    101027982 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    101027982 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101027982 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    101027982 (PIK3CB)
   04660 T cell receptor signaling pathway
    101027982 (PIK3CB)
   04662 B cell receptor signaling pathway
    101027982 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    101027982 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    101027982 (PIK3CB)
   04670 Leukocyte transendothelial migration
    101027982 (PIK3CB)
   04062 Chemokine signaling pathway
    101027982 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101027982 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    101027982 (PIK3CB)
   04929 GnRH secretion
    101027982 (PIK3CB)
   04915 Estrogen signaling pathway
    101027982 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101027982 (PIK3CB)
   04917 Prolactin signaling pathway
    101027982 (PIK3CB)
   04926 Relaxin signaling pathway
    101027982 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    101027982 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    101027982 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101027982 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101027982 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    101027982 (PIK3CB)
   04722 Neurotrophin signaling pathway
    101027982 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101027982 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    101027982 (PIK3CB)
   04380 Osteoclast differentiation
    101027982 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    101027982 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    101027982 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101027982 (PIK3CB)
   05206 MicroRNAs in cancer
    101027982 (PIK3CB)
   05205 Proteoglycans in cancer
    101027982 (PIK3CB)
   05203 Viral carcinogenesis
    101027982 (PIK3CB)
   05230 Central carbon metabolism in cancer
    101027982 (PIK3CB)
   05231 Choline metabolism in cancer
    101027982 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101027982 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101027982 (PIK3CB)
   05212 Pancreatic cancer
    101027982 (PIK3CB)
   05225 Hepatocellular carcinoma
    101027982 (PIK3CB)
   05226 Gastric cancer
    101027982 (PIK3CB)
   05214 Glioma
    101027982 (PIK3CB)
   05221 Acute myeloid leukemia
    101027982 (PIK3CB)
   05220 Chronic myeloid leukemia
    101027982 (PIK3CB)
   05218 Melanoma
    101027982 (PIK3CB)
   05211 Renal cell carcinoma
    101027982 (PIK3CB)
   05215 Prostate cancer
    101027982 (PIK3CB)
   05213 Endometrial cancer
    101027982 (PIK3CB)
   05224 Breast cancer
    101027982 (PIK3CB)
   05222 Small cell lung cancer
    101027982 (PIK3CB)
   05223 Non-small cell lung cancer
    101027982 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101027982 (PIK3CB)
   05017 Spinocerebellar ataxia
    101027982 (PIK3CB)
   05020 Prion disease
    101027982 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101027982 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101027982 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    101027982 (PIK3CB)
   04931 Insulin resistance
    101027982 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101027982 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101027982 (PIK3CB)
   05135 Yersinia infection
    101027982 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    101027982 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101027982 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    101027982 (PIK3CB)
   05161 Hepatitis B
    101027982 (PIK3CB)
   05160 Hepatitis C
    101027982 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    101027982 (PIK3CB)
   05164 Influenza A
    101027982 (PIK3CB)
   05162 Measles
    101027982 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    101027982 (PIK3CB)
   05163 Human cytomegalovirus infection
    101027982 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101027982 (PIK3CB)
   05169 Epstein-Barr virus infection
    101027982 (PIK3CB)
   05165 Human papillomavirus infection
    101027982 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101027982 (PIK3CB)
   05142 Chagas disease
    101027982 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101027982 (PIK3CB)
   01524 Platinum drug resistance
    101027982 (PIK3CB)
   01522 Endocrine resistance
    101027982 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101027982 (PIK3CB)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101027982 (PIK3CB)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101027982 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101027982
NCBI-ProteinID: XP_003931023
UniProt: A0A2K6SKI4
LinkDB
Position
Unknown
AA seq 1070 aa
MCFGFIMPPAMADILDIWAVDSQIASDGTIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDGLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
ISPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVVNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIIYHVWENNNPFQIILVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEVSGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKAKTKKSTKAI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcggtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggcaccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaaccttcttatggaaattgactcctatatgttt
gcatgtgtgaatcagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgatccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctccatgaatttgatggcttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagcgaggaaaagatc
ctgtcacttgtgggattatcttggatggactggctaaaacaaacatatccaccagagcat
gaaccatccatccctgaaaacttagaagataaactttatggaggaaagctcattgtagct
gttcattttgaaaactcccaggatgtgtttagctttcaagtatctccgaatatgaatcct
ataaaagtaaatgaattggcaatccagaaacgtttgactattcatgggaaggaagatgaa
attagcccctatgattatgtgttgcaagtcagtgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccggaactgtgtagtgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatagaaattcatctaatcttcctcttccattaccaccaaagaaaaca
cgaattatttatcatgtttgggaaaataacaaccctttccaaattatcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaacagtcgtaagctctgaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatatcaatacttgtgacttaccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagcaaaaacaaagaaatcaacgaaagctatt
aatccctctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttccagatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatactgaaaatgcaacagctttgcatattaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggaggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagaatttcccacagtcactgccaaagttactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactgcttcagatttggcctaaa
ctgcccccgcgggaggccctggagcttctggatttcaactatccagaccagtacgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttgctaatcggaggatagggcagtttctattttggcatcttaggtcg
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttccaagcaggttgaagccctcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagttaaacagagccaaagggaaggag
gccatgcacacctgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cccctgaacccatgtgttatcctctcggaactctatgttgaaaaatgcaaatacatggat
tccaaaatgaagcctttgtggctggtgtacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaaatgttg
cgcttgatggatttactctggaaagaagctggtttggatcttcggatgttgccttacggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgctgcagccttcaacaaagatgcc
cttctgaattggctcaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttactctgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgattttggacat
attcttggaaatttcaaatcaaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcagcaaggaaaaacaggaaatacagaaaagtttggc
cggttccgtcagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcattgatgttgactgcagggcttcctgaactcacatcagtcaaggat
atacagtatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaaacag
tttaaacaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029768
Entry
101029768         CDS       T04350                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101029768 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101029768 (PIK3CA)
   04014 Ras signaling pathway
    101029768 (PIK3CA)
   04015 Rap1 signaling pathway
    101029768 (PIK3CA)
   04370 VEGF signaling pathway
    101029768 (PIK3CA)
   04630 JAK-STAT signaling pathway
    101029768 (PIK3CA)
   04668 TNF signaling pathway
    101029768 (PIK3CA)
   04066 HIF-1 signaling pathway
    101029768 (PIK3CA)
   04068 FoxO signaling pathway
    101029768 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    101029768 (PIK3CA)
   04072 Phospholipase D signaling pathway
    101029768 (PIK3CA)
   04071 Sphingolipid signaling pathway
    101029768 (PIK3CA)
   04024 cAMP signaling pathway
    101029768 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    101029768 (PIK3CA)
   04152 AMPK signaling pathway
    101029768 (PIK3CA)
   04150 mTOR signaling pathway
    101029768 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101029768 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    101029768 (PIK3CA)
   04218 Cellular senescence
    101029768 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101029768 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    101029768 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101029768 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101029768 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    101029768 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    101029768 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    101029768 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    101029768 (PIK3CA)
   04660 T cell receptor signaling pathway
    101029768 (PIK3CA)
   04662 B cell receptor signaling pathway
    101029768 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    101029768 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    101029768 (PIK3CA)
   04670 Leukocyte transendothelial migration
    101029768 (PIK3CA)
   04062 Chemokine signaling pathway
    101029768 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101029768 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    101029768 (PIK3CA)
   04929 GnRH secretion
    101029768 (PIK3CA)
   04915 Estrogen signaling pathway
    101029768 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    101029768 (PIK3CA)
   04917 Prolactin signaling pathway
    101029768 (PIK3CA)
   04926 Relaxin signaling pathway
    101029768 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    101029768 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    101029768 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101029768 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101029768 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    101029768 (PIK3CA)
   04722 Neurotrophin signaling pathway
    101029768 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101029768 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    101029768 (PIK3CA)
   04380 Osteoclast differentiation
    101029768 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    101029768 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    101029768 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029768 (PIK3CA)
   05206 MicroRNAs in cancer
    101029768 (PIK3CA)
   05205 Proteoglycans in cancer
    101029768 (PIK3CA)
   05203 Viral carcinogenesis
    101029768 (PIK3CA)
   05230 Central carbon metabolism in cancer
    101029768 (PIK3CA)
   05231 Choline metabolism in cancer
    101029768 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101029768 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101029768 (PIK3CA)
   05212 Pancreatic cancer
    101029768 (PIK3CA)
   05225 Hepatocellular carcinoma
    101029768 (PIK3CA)
   05226 Gastric cancer
    101029768 (PIK3CA)
   05214 Glioma
    101029768 (PIK3CA)
   05221 Acute myeloid leukemia
    101029768 (PIK3CA)
   05220 Chronic myeloid leukemia
    101029768 (PIK3CA)
   05218 Melanoma
    101029768 (PIK3CA)
   05211 Renal cell carcinoma
    101029768 (PIK3CA)
   05215 Prostate cancer
    101029768 (PIK3CA)
   05213 Endometrial cancer
    101029768 (PIK3CA)
   05224 Breast cancer
    101029768 (PIK3CA)
   05222 Small cell lung cancer
    101029768 (PIK3CA)
   05223 Non-small cell lung cancer
    101029768 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101029768 (PIK3CA)
   05017 Spinocerebellar ataxia
    101029768 (PIK3CA)
   05020 Prion disease
    101029768 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101029768 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101029768 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    101029768 (PIK3CA)
   04931 Insulin resistance
    101029768 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101029768 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101029768 (PIK3CA)
   05135 Yersinia infection
    101029768 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    101029768 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101029768 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    101029768 (PIK3CA)
   05161 Hepatitis B
    101029768 (PIK3CA)
   05160 Hepatitis C
    101029768 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    101029768 (PIK3CA)
   05164 Influenza A
    101029768 (PIK3CA)
   05162 Measles
    101029768 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    101029768 (PIK3CA)
   05163 Human cytomegalovirus infection
    101029768 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029768 (PIK3CA)
   05169 Epstein-Barr virus infection
    101029768 (PIK3CA)
   05165 Human papillomavirus infection
    101029768 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101029768 (PIK3CA)
   05142 Chagas disease
    101029768 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101029768 (PIK3CA)
   01524 Platinum drug resistance
    101029768 (PIK3CA)
   01522 Endocrine resistance
    101029768 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101029768 (PIK3CA)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101029768 (PIK3CA)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101029768 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 101029768
NCBI-ProteinID: XP_003926970
UniProt: A0A2K6SFQ5
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWSEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggtatccacttgatgcccccaagaatc
ctcgtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattggtaactataaagcatgaactctttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgggaaattgggtttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggttatagtttctcca
aataatgacaagcagaaatatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacgccgtatatgaatgga
gagacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtgaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcagagagtaccttgttccaat
cccaggtggagtgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cggctttgcctttccatttgttccgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtgtctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagacatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacaggctagctagagac
aatgaattgagggaaaatgacaaagaacagctcagagcaatttgtacacgggatcctctc
tctgaaatcactgagcaggagaaagattttctgtggagccaccgacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagtt
gcccagatgtactgcttggtaaaagactggcctccaatcaagcctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggttcggcctgctcctggagtcctattgccgtgcctgtgggatgtatctgaag
cacctgaacaggcaagtcgaggcgatggagaagcttatcaacctgactgacatcctcaag
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctgcagggctttctgtctcctctaaaccctgctcatcaa
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ctgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgctaccttacggttgtctgtcc
atcggtgactgtgtggggcttatcgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcctgaaaggcgcactgcagttcaacagccacacgctgcaccagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgatctgtttacgcgttct
tgtgctggatattgtgtagctaccttcattctgggaattggagatcgtcacaatagtaac
atcatggtgaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgacgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaatcaagcagcacgcactgaactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032496
Entry
101032496         CDS       T04350                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101032496 (PIK3R1)
   04014 Ras signaling pathway
    101032496 (PIK3R1)
   04015 Rap1 signaling pathway
    101032496 (PIK3R1)
   04370 VEGF signaling pathway
    101032496 (PIK3R1)
   04630 JAK-STAT signaling pathway
    101032496 (PIK3R1)
   04668 TNF signaling pathway
    101032496 (PIK3R1)
   04066 HIF-1 signaling pathway
    101032496 (PIK3R1)
   04068 FoxO signaling pathway
    101032496 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    101032496 (PIK3R1)
   04072 Phospholipase D signaling pathway
    101032496 (PIK3R1)
   04071 Sphingolipid signaling pathway
    101032496 (PIK3R1)
   04024 cAMP signaling pathway
    101032496 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    101032496 (PIK3R1)
   04152 AMPK signaling pathway
    101032496 (PIK3R1)
   04150 mTOR signaling pathway
    101032496 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101032496 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    101032496 (PIK3R1)
   04218 Cellular senescence
    101032496 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101032496 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101032496 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101032496 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101032496 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    101032496 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    101032496 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    101032496 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    101032496 (PIK3R1)
   04660 T cell receptor signaling pathway
    101032496 (PIK3R1)
   04662 B cell receptor signaling pathway
    101032496 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    101032496 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    101032496 (PIK3R1)
   04670 Leukocyte transendothelial migration
    101032496 (PIK3R1)
   04062 Chemokine signaling pathway
    101032496 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101032496 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    101032496 (PIK3R1)
   04929 GnRH secretion
    101032496 (PIK3R1)
   04915 Estrogen signaling pathway
    101032496 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    101032496 (PIK3R1)
   04917 Prolactin signaling pathway
    101032496 (PIK3R1)
   04926 Relaxin signaling pathway
    101032496 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    101032496 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    101032496 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101032496 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101032496 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    101032496 (PIK3R1)
   04722 Neurotrophin signaling pathway
    101032496 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101032496 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    101032496 (PIK3R1)
   04380 Osteoclast differentiation
    101032496 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    101032496 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    101032496 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032496 (PIK3R1)
   05206 MicroRNAs in cancer
    101032496 (PIK3R1)
   05205 Proteoglycans in cancer
    101032496 (PIK3R1)
   05203 Viral carcinogenesis
    101032496 (PIK3R1)
   05230 Central carbon metabolism in cancer
    101032496 (PIK3R1)
   05231 Choline metabolism in cancer
    101032496 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101032496 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101032496 (PIK3R1)
   05212 Pancreatic cancer
    101032496 (PIK3R1)
   05225 Hepatocellular carcinoma
    101032496 (PIK3R1)
   05226 Gastric cancer
    101032496 (PIK3R1)
   05214 Glioma
    101032496 (PIK3R1)
   05221 Acute myeloid leukemia
    101032496 (PIK3R1)
   05220 Chronic myeloid leukemia
    101032496 (PIK3R1)
   05218 Melanoma
    101032496 (PIK3R1)
   05211 Renal cell carcinoma
    101032496 (PIK3R1)
   05215 Prostate cancer
    101032496 (PIK3R1)
   05213 Endometrial cancer
    101032496 (PIK3R1)
   05224 Breast cancer
    101032496 (PIK3R1)
   05222 Small cell lung cancer
    101032496 (PIK3R1)
   05223 Non-small cell lung cancer
    101032496 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101032496 (PIK3R1)
   05017 Spinocerebellar ataxia
    101032496 (PIK3R1)
   05020 Prion disease
    101032496 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101032496 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101032496 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    101032496 (PIK3R1)
   04931 Insulin resistance
    101032496 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101032496 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101032496 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    101032496 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101032496 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    101032496 (PIK3R1)
   05161 Hepatitis B
    101032496 (PIK3R1)
   05160 Hepatitis C
    101032496 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    101032496 (PIK3R1)
   05164 Influenza A
    101032496 (PIK3R1)
   05162 Measles
    101032496 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    101032496 (PIK3R1)
   05163 Human cytomegalovirus infection
    101032496 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032496 (PIK3R1)
   05169 Epstein-Barr virus infection
    101032496 (PIK3R1)
   05165 Human papillomavirus infection
    101032496 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101032496 (PIK3R1)
   05142 Chagas disease
    101032496 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101032496 (PIK3R1)
   01524 Platinum drug resistance
    101032496 (PIK3R1)
   01522 Endocrine resistance
    101032496 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101032496 (PIK3R1)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101032496 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 101032496
NCBI-ProteinID: XP_010334855
UniProt: A0A2K6V569
LinkDB
Position
Unknown
AA seq 727 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVAHGFTDGQESRPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQGQYALTLPD
LAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDAASVDLEMI
DVHVLADAFKRYLLDLPNPVIPAAIYSEMISLAQEVQSSEEYVQLLKKLIRSPSIPHQYW
LTLQYLLKHFFRLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNIENLIKVIEILISTE
WNERQPAPALPPKPPKPATVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLV
RDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYN
PKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEI
QMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISE
IIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEW
LGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCY
ACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYAQQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcactgtatgattataaaaaggaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtctttagtagctcat
ggattcactgatggacaggagtccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccaggaacttatgtagaatatattggaaggaaa
aaaatctcacctcccacaccaaagccccggccacctcgtcctcttcctgttgcaccaggt
tcttccaaaactgaagcagatgtggagcagcaaggtcagtatgctttgactcttccggat
cttgcagagcagtttgcccctcctgacattgccccacctcttcttatcaagcttgtggaa
gccattgaaaagaaaggtctggaatgttcaactttatacaggacacagagctccagcaac
ctggcagaattacgacagcttcttgattgtgatgcggcctctgtggacttggaaatgata
gatgtgcacgttttggcagacgcttttaaacgctatctcctggacttaccaaatcctgtc
attccagcagccatttacagtgaaatgatttctttagctcaagaagtacaaagctctgaa
gaatatgtacagctattgaagaagcttattaggtcacctagcatacctcatcagtattgg
cttacacttcagtatttgttaaaacatttcttcaggctctctcaaacctccagcaaaaat
ctattgaatgcaagagttctctctgaaattttcagccctatgcttttcagattctcagca
gccagctctgataatattgaaaacctcataaaagttatagaaattttaatctcaactgaa
tggaatgaacgacagcctgcaccagcactgcctcctaaaccaccaaaacccgctactgta
gccaacaacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagat
atctcgagggaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggta
cgagatgcgtctactaaaatgcatggtgattatactcttacactaaggaaagggggaaat
aacaaattaatcaaaatatttcatcgagatgggaaatatggcttctctgacccattaacc
ttcaattctgtggttgaactaataaaccactaccggaatgaatctctagctcagtataat
cccaaattggatgtgaaattactttatccagtatctaaataccagcaggatcaagttgtc
aaagaagataatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaa
gaaaaaagtcgggaatatgataggttatatgaagaatatacccgtacatcccaggaaatc
caaatgaaaagaacagctattgaagcattcaatgaaaccataaaaatatttgaagagcag
tgccagacccaagagcggtacagcaaagaatacatagaaaagtttaaacgtgaagggaat
gagaaagaaatacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaa
attattgacagtagaagaagattggaagaagacttgaagaagcaggcagctgagtatcga
gaaattgacaaacgtatgaacagcattaaacctgaccttatccagctgagaaagacgaga
gaccaatacttgatgtggttaactcaaaaaggtgttcggcaaaagaagttgaacgagtgg
ctgggcaatgaaaacactgaagaccaatattcgttggtggaagatgatgaagatttgcct
catcatgatgagaagacatggaatgtcggaagcagcaacagaaacaaagctgaaaacctg
ttgcgagggaagcgagatggcacttttcttgtccgcgagagcagtaaacagggctgctac
gcctgctctgttgtggtggatggcgaagtaaagcattgtgtcataaacaaaacagcgact
ggctatggctttgccgagccctataacttgtacagctctctgaaggaactggtgctacat
taccaacacacttccctcgttcagcacaacgactccctcaacgtcacactagcctaccca
gtatatgcacagcagaggcgatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033359
Entry
101033359         CDS       T04350                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101033359 (PIK3R2)
   04014 Ras signaling pathway
    101033359 (PIK3R2)
   04015 Rap1 signaling pathway
    101033359 (PIK3R2)
   04370 VEGF signaling pathway
    101033359 (PIK3R2)
   04630 JAK-STAT signaling pathway
    101033359 (PIK3R2)
   04668 TNF signaling pathway
    101033359 (PIK3R2)
   04066 HIF-1 signaling pathway
    101033359 (PIK3R2)
   04068 FoxO signaling pathway
    101033359 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    101033359 (PIK3R2)
   04072 Phospholipase D signaling pathway
    101033359 (PIK3R2)
   04071 Sphingolipid signaling pathway
    101033359 (PIK3R2)
   04024 cAMP signaling pathway
    101033359 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    101033359 (PIK3R2)
   04152 AMPK signaling pathway
    101033359 (PIK3R2)
   04150 mTOR signaling pathway
    101033359 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101033359 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    101033359 (PIK3R2)
   04218 Cellular senescence
    101033359 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101033359 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101033359 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101033359 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101033359 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    101033359 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    101033359 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    101033359 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    101033359 (PIK3R2)
   04660 T cell receptor signaling pathway
    101033359 (PIK3R2)
   04662 B cell receptor signaling pathway
    101033359 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    101033359 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    101033359 (PIK3R2)
   04670 Leukocyte transendothelial migration
    101033359 (PIK3R2)
   04062 Chemokine signaling pathway
    101033359 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101033359 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    101033359 (PIK3R2)
   04929 GnRH secretion
    101033359 (PIK3R2)
   04915 Estrogen signaling pathway
    101033359 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    101033359 (PIK3R2)
   04917 Prolactin signaling pathway
    101033359 (PIK3R2)
   04926 Relaxin signaling pathway
    101033359 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    101033359 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    101033359 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101033359 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101033359 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    101033359 (PIK3R2)
   04722 Neurotrophin signaling pathway
    101033359 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101033359 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    101033359 (PIK3R2)
   04380 Osteoclast differentiation
    101033359 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    101033359 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    101033359 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033359 (PIK3R2)
   05206 MicroRNAs in cancer
    101033359 (PIK3R2)
   05205 Proteoglycans in cancer
    101033359 (PIK3R2)
   05203 Viral carcinogenesis
    101033359 (PIK3R2)
   05230 Central carbon metabolism in cancer
    101033359 (PIK3R2)
   05231 Choline metabolism in cancer
    101033359 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101033359 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101033359 (PIK3R2)
   05212 Pancreatic cancer
    101033359 (PIK3R2)
   05225 Hepatocellular carcinoma
    101033359 (PIK3R2)
   05226 Gastric cancer
    101033359 (PIK3R2)
   05214 Glioma
    101033359 (PIK3R2)
   05221 Acute myeloid leukemia
    101033359 (PIK3R2)
   05220 Chronic myeloid leukemia
    101033359 (PIK3R2)
   05218 Melanoma
    101033359 (PIK3R2)
   05211 Renal cell carcinoma
    101033359 (PIK3R2)
   05215 Prostate cancer
    101033359 (PIK3R2)
   05213 Endometrial cancer
    101033359 (PIK3R2)
   05224 Breast cancer
    101033359 (PIK3R2)
   05222 Small cell lung cancer
    101033359 (PIK3R2)
   05223 Non-small cell lung cancer
    101033359 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101033359 (PIK3R2)
   05017 Spinocerebellar ataxia
    101033359 (PIK3R2)
   05020 Prion disease
    101033359 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101033359 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101033359 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    101033359 (PIK3R2)
   04931 Insulin resistance
    101033359 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101033359 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101033359 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    101033359 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101033359 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    101033359 (PIK3R2)
   05161 Hepatitis B
    101033359 (PIK3R2)
   05160 Hepatitis C
    101033359 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    101033359 (PIK3R2)
   05164 Influenza A
    101033359 (PIK3R2)
   05162 Measles
    101033359 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    101033359 (PIK3R2)
   05163 Human cytomegalovirus infection
    101033359 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101033359 (PIK3R2)
   05169 Epstein-Barr virus infection
    101033359 (PIK3R2)
   05165 Human papillomavirus infection
    101033359 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101033359 (PIK3R2)
   05142 Chagas disease
    101033359 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101033359 (PIK3R2)
   01524 Platinum drug resistance
    101033359 (PIK3R2)
   01522 Endocrine resistance
    101033359 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101033359 (PIK3R2)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101033359 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 DUF4201 ATG11 SH3_2 Ribosomal_L22e ING Tai4 TACC_C
Other DBs
NCBI-GeneID: 101033359
NCBI-ProteinID: XP_010328510
LinkDB
Position
Unknown
AA seq 673 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPVPARPRDGASEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESYYRPELPALRTDWSLSDVDQWDAAALADGIKSFLLA
LPAPLVTPEASAEARRALWEAGGPVGPSPPPGGAPDGSEPSPDFSALLVEKLLQEHLEEQ
EVAPPALPPKPPKAKPVPAGLANGGSPLSLQDAEWYWGDISREEVNEKLRDTPDGTFLVR
DASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLISHYRHESLAQYNA
KLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQ
MKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEI
HESRTKLEQQLRAQASDIREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWL
GIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCY
ACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAPP
VRAPGPGPPPAAR
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgcgctctgtacccgttccgccgggagcggcca
gaggacctggagctgctgccgggcgacgtgctggtggtgagccgggcggccttgcaggca
ctgggcgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aatgaacgcacacggcagcgaggtgacttccctggcacctacgtcgagttcctggggcct
gtggccctggcccggcccggccctcgcccacggggtccccgcccagtgcccgccaggccc
cgggatggggcctctgagccaggcctcacactccctgacttgcctgagcagttctcccca
cctgatgtggcgccccctcttctggtgaagcttgtagaggccattgaacggacggggctg
gacagcgaatcttactaccggccggagctccccgcactgcgtacagactggtccctgagc
gacgtggatcagtgggacgcagcagccctggccgatggcattaagagcttcctgctggca
ctgcccgcgccgctggtgacccccgaggcctcggcggaggcgcgccgggccctgtgggag
gccgggggacccgtggggccgtcaccgccgccaggaggcgcgcccgacgggagtgagccc
agccctgacttctcggcgctgctcgtggagaagctgcttcaggaacacttggaagagcag
gaggtcgcgcccccagcgctgccacctaaaccccccaaggcaaagccggtccccgcaggc
ctggccaatggggggagcccactgtccctgcaagatgctgagtggtactggggggacatc
tcaagggaggaggtgaatgagaaactccgggacactcctgatggcactttcctagtccga
gatgcgtccagcaagatccagggcgagtacacgctgaccctcaggaaaggcgggaacaat
aagctaatcaaggtcttccaccgggacgggcactatggcttctcggagccgctcaccttc
tgctccgttgtcgacctcatcagtcactaccgccacgagtccctggcccagtacaacgcc
aagctggacacgcggctcctctaccctgtgtccaaataccagcaggaccagatcgtcaag
gaggacagcgtggaggcggtgggcgcccagctcaaggtctatcaccagcagtaccaggac
aagagccgcgagtatgaccagctttatgaggagtacacacggacctcccaggagctgcag
atgaagcggacggcaattgaggccttcaatgagactatcaagatcttcgaagagcagggc
cagactcaggagaagtgcagcaaggaatacctggagcgcttccggcgcgagggcaacgag
aaggagatgcagaggatcctgctgaactcagagcggctcaagtcccgcattgctgagatc
cacgagagccgcacgaagctggagcagcagctgcgggcccaggcctcggacatccgcgaa
atcgacaagcgcatgaacagcctcaagccggacctcatgcagctgcgcaagatccgagac
cagtacctcgtatggctcacccagaaaggtgcccggcagaagaaaatcaatgagtggctg
gggatcaaaaatgagactgaggaccagtacgcactgatggaggatgaggatgatcttccc
caccacgaagagcgcacttggtacgtgggcaagatcaaccgcacgcaggcggaggagatg
ctgagcggcaagcgcgacggcacgttcctcatccgcgagagcagccagcggggctgctac
gcctgctccgtggtggtagacggcgacaccaagcactgcgtcatctaccgcacggccacc
ggcttcggcttcgcggaaccctacaacctgtacgggtcgctgaaggagctggtgctgcac
taccagcacgcctcgctcgtgcagcacaacgacgcgctcacggtcaccctggcgcccccg
gtgcgcgccccgggccccggcccgccgcctgccgcccgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050592
Entry
101050592         CDS       T04350                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101050592 (PIK3R3)
   04014 Ras signaling pathway
    101050592 (PIK3R3)
   04015 Rap1 signaling pathway
    101050592 (PIK3R3)
   04370 VEGF signaling pathway
    101050592 (PIK3R3)
   04630 JAK-STAT signaling pathway
    101050592 (PIK3R3)
   04668 TNF signaling pathway
    101050592 (PIK3R3)
   04066 HIF-1 signaling pathway
    101050592 (PIK3R3)
   04068 FoxO signaling pathway
    101050592 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    101050592 (PIK3R3)
   04072 Phospholipase D signaling pathway
    101050592 (PIK3R3)
   04071 Sphingolipid signaling pathway
    101050592 (PIK3R3)
   04024 cAMP signaling pathway
    101050592 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    101050592 (PIK3R3)
   04152 AMPK signaling pathway
    101050592 (PIK3R3)
   04150 mTOR signaling pathway
    101050592 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101050592 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    101050592 (PIK3R3)
   04218 Cellular senescence
    101050592 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101050592 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101050592 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101050592 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101050592 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    101050592 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    101050592 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    101050592 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    101050592 (PIK3R3)
   04660 T cell receptor signaling pathway
    101050592 (PIK3R3)
   04662 B cell receptor signaling pathway
    101050592 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    101050592 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    101050592 (PIK3R3)
   04670 Leukocyte transendothelial migration
    101050592 (PIK3R3)
   04062 Chemokine signaling pathway
    101050592 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101050592 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    101050592 (PIK3R3)
   04929 GnRH secretion
    101050592 (PIK3R3)
   04915 Estrogen signaling pathway
    101050592 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    101050592 (PIK3R3)
   04917 Prolactin signaling pathway
    101050592 (PIK3R3)
   04926 Relaxin signaling pathway
    101050592 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    101050592 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    101050592 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101050592 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101050592 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    101050592 (PIK3R3)
   04722 Neurotrophin signaling pathway
    101050592 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101050592 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    101050592 (PIK3R3)
   04380 Osteoclast differentiation
    101050592 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    101050592 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    101050592 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050592 (PIK3R3)
   05206 MicroRNAs in cancer
    101050592 (PIK3R3)
   05205 Proteoglycans in cancer
    101050592 (PIK3R3)
   05203 Viral carcinogenesis
    101050592 (PIK3R3)
   05230 Central carbon metabolism in cancer
    101050592 (PIK3R3)
   05231 Choline metabolism in cancer
    101050592 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101050592 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101050592 (PIK3R3)
   05212 Pancreatic cancer
    101050592 (PIK3R3)
   05225 Hepatocellular carcinoma
    101050592 (PIK3R3)
   05226 Gastric cancer
    101050592 (PIK3R3)
   05214 Glioma
    101050592 (PIK3R3)
   05221 Acute myeloid leukemia
    101050592 (PIK3R3)
   05220 Chronic myeloid leukemia
    101050592 (PIK3R3)
   05218 Melanoma
    101050592 (PIK3R3)
   05211 Renal cell carcinoma
    101050592 (PIK3R3)
   05215 Prostate cancer
    101050592 (PIK3R3)
   05213 Endometrial cancer
    101050592 (PIK3R3)
   05224 Breast cancer
    101050592 (PIK3R3)
   05222 Small cell lung cancer
    101050592 (PIK3R3)
   05223 Non-small cell lung cancer
    101050592 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101050592 (PIK3R3)
   05017 Spinocerebellar ataxia
    101050592 (PIK3R3)
   05020 Prion disease
    101050592 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101050592 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101050592 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    101050592 (PIK3R3)
   04931 Insulin resistance
    101050592 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101050592 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101050592 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    101050592 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101050592 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    101050592 (PIK3R3)
   05161 Hepatitis B
    101050592 (PIK3R3)
   05160 Hepatitis C
    101050592 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    101050592 (PIK3R3)
   05164 Influenza A
    101050592 (PIK3R3)
   05162 Measles
    101050592 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    101050592 (PIK3R3)
   05163 Human cytomegalovirus infection
    101050592 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101050592 (PIK3R3)
   05169 Epstein-Barr virus infection
    101050592 (PIK3R3)
   05165 Human papillomavirus infection
    101050592 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101050592 (PIK3R3)
   05142 Chagas disease
    101050592 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101050592 (PIK3R3)
   01524 Platinum drug resistance
    101050592 (PIK3R3)
   01522 Endocrine resistance
    101050592 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101050592 (PIK3R3)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101050592 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 101050592
NCBI-ProteinID: XP_003936941
UniProt: A0A2K6TA54
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDCSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggaatgaaggactgttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccagatggaaccttcttggtccgagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagttaataaagatctatcaccgggatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaaacttgatgtgaagttgatgtacccagtg
tcccgataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctacaagaataccactctcagtatcaggagaagagtaaagagtatgataggctatatgaa
gaatatactagaacatcccaggaaatacagatgaagaggaccgcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagagcaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggcgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgaaagatccgagatcaacaccttgtatggctcaatcacaaagga
gtgagacagaaacgtctgaatgcctggctgggaattaagaatgaggatgctgatgagaac
tattttattaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgacggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgctctgtggtggccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgctgagccttacaac
ctgtacagctctctgaaggagctggtgctccattaccagcagacatccttggttcagcac
aacgactccctcaacgtcaggcttgcctaccctgttcatgcacagatgccctcgctctgc
agataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052779
Entry
101052779         CDS       T04350                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101052779 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101052779 (PIK3CD)
   04014 Ras signaling pathway
    101052779 (PIK3CD)
   04015 Rap1 signaling pathway
    101052779 (PIK3CD)
   04370 VEGF signaling pathway
    101052779 (PIK3CD)
   04630 JAK-STAT signaling pathway
    101052779 (PIK3CD)
   04668 TNF signaling pathway
    101052779 (PIK3CD)
   04066 HIF-1 signaling pathway
    101052779 (PIK3CD)
   04068 FoxO signaling pathway
    101052779 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101052779 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101052779 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101052779 (PIK3CD)
   04024 cAMP signaling pathway
    101052779 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101052779 (PIK3CD)
   04152 AMPK signaling pathway
    101052779 (PIK3CD)
   04150 mTOR signaling pathway
    101052779 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101052779 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    101052779 (PIK3CD)
   04218 Cellular senescence
    101052779 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052779 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101052779 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052779 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101052779 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    101052779 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101052779 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101052779 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101052779 (PIK3CD)
   04660 T cell receptor signaling pathway
    101052779 (PIK3CD)
   04662 B cell receptor signaling pathway
    101052779 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101052779 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101052779 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101052779 (PIK3CD)
   04062 Chemokine signaling pathway
    101052779 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101052779 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    101052779 (PIK3CD)
   04929 GnRH secretion
    101052779 (PIK3CD)
   04915 Estrogen signaling pathway
    101052779 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101052779 (PIK3CD)
   04917 Prolactin signaling pathway
    101052779 (PIK3CD)
   04926 Relaxin signaling pathway
    101052779 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    101052779 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101052779 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101052779 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101052779 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    101052779 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101052779 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101052779 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    101052779 (PIK3CD)
   04380 Osteoclast differentiation
    101052779 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    101052779 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101052779 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052779 (PIK3CD)
   05206 MicroRNAs in cancer
    101052779 (PIK3CD)
   05205 Proteoglycans in cancer
    101052779 (PIK3CD)
   05203 Viral carcinogenesis
    101052779 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101052779 (PIK3CD)
   05231 Choline metabolism in cancer
    101052779 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101052779 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052779 (PIK3CD)
   05212 Pancreatic cancer
    101052779 (PIK3CD)
   05225 Hepatocellular carcinoma
    101052779 (PIK3CD)
   05226 Gastric cancer
    101052779 (PIK3CD)
   05214 Glioma
    101052779 (PIK3CD)
   05221 Acute myeloid leukemia
    101052779 (PIK3CD)
   05220 Chronic myeloid leukemia
    101052779 (PIK3CD)
   05218 Melanoma
    101052779 (PIK3CD)
   05211 Renal cell carcinoma
    101052779 (PIK3CD)
   05215 Prostate cancer
    101052779 (PIK3CD)
   05213 Endometrial cancer
    101052779 (PIK3CD)
   05224 Breast cancer
    101052779 (PIK3CD)
   05222 Small cell lung cancer
    101052779 (PIK3CD)
   05223 Non-small cell lung cancer
    101052779 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101052779 (PIK3CD)
   05017 Spinocerebellar ataxia
    101052779 (PIK3CD)
   05020 Prion disease
    101052779 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052779 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101052779 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    101052779 (PIK3CD)
   04931 Insulin resistance
    101052779 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101052779 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101052779 (PIK3CD)
   05135 Yersinia infection
    101052779 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    101052779 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101052779 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    101052779 (PIK3CD)
   05161 Hepatitis B
    101052779 (PIK3CD)
   05160 Hepatitis C
    101052779 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    101052779 (PIK3CD)
   05164 Influenza A
    101052779 (PIK3CD)
   05162 Measles
    101052779 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    101052779 (PIK3CD)
   05163 Human cytomegalovirus infection
    101052779 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101052779 (PIK3CD)
   05169 Epstein-Barr virus infection
    101052779 (PIK3CD)
   05165 Human papillomavirus infection
    101052779 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101052779 (PIK3CD)
   05142 Chagas disease
    101052779 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101052779 (PIK3CD)
   01524 Platinum drug resistance
    101052779 (PIK3CD)
   01522 Endocrine resistance
    101052779 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101052779 (PIK3CD)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101052779 (PIK3CD)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101052779 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 101052779
NCBI-ProteinID: XP_003927963
UniProt: A0A2K6T7I0
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLNGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRTKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKSTVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHFSSILAMRDEQSNPTPQVQKPR
AKPPPIPAKKPSSVSLWSLDQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDISISDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLHMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
YPVYYPSLEKILELGRHSECVRVTEEEQLQLREILERRGCGELYEHEKDLLWKLRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLGALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSSGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttcccggtgtctcgcaatgcc
aacctcagcaccatcaagcagctgctatggcaccgtgcccagtacgagccgctcttccac
atgctcaacggccccgaggcctatgtgttcacctgcatcaaccagacggccgagcagcag
gagctggaggatgagcagcggcggctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggcgaccgcgtgaagaagctcatcaactcgcagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgt
accaagatgtgccagttctgcgaggaggcggctgcgcgccggcagcagctgggctgggag
gcctggctgcagtacagcttcccgctgcagctggagccctcggctcgaacctgggggccc
ggcaccctgcggctccccaaccgggccctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggatgtgccgctggcgctgatggcctgtgcc
ctgcggaagaagtccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcacgagtacctgtacggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagcgggctgacccctcacctgaccatggtccacttctcc
tccatcctcgccatgcgcgatgagcagagcaaccccaccccccaggtccagaagcctcgc
gccaagccgcctcccattcctgcaaagaagccctcctctgtgtccctgtggtccctggac
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggctgggcttttccacggtaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagtttgacatcagc
atcagtgacctgccccgcatggcccgtctctgctttgccctctacgctgtgattgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactataaggaccagcttaagaccggggaacgctgcctccac
atgtggccctctgtcccagatgagaagggggagctgctgaaccccactggcacggtgcgc
agtaaccccaacacagacagtgccgccgccctgctgatctgcctgcctgaggtggccccg
tatcccgtgtactacccgtccctggagaagatcttggagctggggcggcacagcgagtgt
gtgcgtgtcacggaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtgt
ggggagctgtatgagcacgagaaggacctcctgtggaagctgcggcatgaagtccaggag
cgcttcccggaggcgctagcccggctgctgttggtcaccaagtggaacaagcatgaggat
gtggcccagatgctgtacctgctgtgttcctggccagaactgcctgtcctgggcgcccta
gagctgctggacttcagcttccctgattgccacgtgggttcctttgccatcaagtccctg
cggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcttgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccatcagtg
gccctgcgctttggcctcatcctggaggcttactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaagctgaaggccctgaatgacttcgtcaag
ctgagctctcagaagacccccaagccccagaccaaggagctgatgcacctgtgcatgcgg
caggaggcctacctggaggccctctcccacctgcagtcccctctcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagccgctgtgg
atcatgtatagcaacgaggaggccggcagcagcggcagtgtgggcatcatctttaagaat
ggggacgacctccggcaggatatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctatggctgcctccccaccggagac
cgcaccggcctcattgaggtggtcctccgctcagacaccatcgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccatcgaggagttcacgctctcctgtgct
ggctactgcgtggccacgtacgtgctgggcatcggcgatcgacacagtgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgtgtcccgttcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcttacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacattcagtatctcaaggat
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtaaagtttaac
gaggccctccgcgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

DBGET integrated database retrieval system