KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028074
Entry
101028074         CDS       T04350                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq03430  Mismatch repair
sbq03460  Fanconi anemia pathway
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101028074 (MLH1)
   03460 Fanconi anemia pathway
    101028074 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101028074 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101028074 (MLH1)
   05226 Gastric cancer
    101028074 (MLH1)
   05213 Endometrial cancer
    101028074 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101028074 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101028074 (MLH1)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     101028074 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 101028074
NCBI-ProteinID: XP_003930956
UniProt: A0A2K6TQ60
LinkDB
Position
Unknown
AA seq 758 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRREDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAF
RMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMV
KSTTSLTSSSTSGSGDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQATVPEDKTDIS
SGRARQQDEEMLELPAPAEVAAKNQILEGDTTKGTSEMSEKRGPTSSPGNPRKRHREDSD
VDMVEDDSRKDMTAACTPRRRIINLTSVLSLQEEINERGHEILREMLHNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSISDSWKWTVEH
IVYKALRSHILPPKHFTEDGNILQLANLPDLYRVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgttcgtggctggggttattcggcggctggacgagacggtggtgaaccgcatagcg
gcgggggaagttatccagcggccggctaacgctatcaaagagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgttaaagagggaggcctgaagttgattcag
atccaagacaatggcactgggatcaggagagaagatctggatattgtatgtgagaggttc
actacgagtaaactgcagtcctttgaggatttagccagtatttccacctatggctttcga
ggtgaggctttggccagcataagtcatgtggctcatgttactattacaacaaaaacagct
gatggaaagtgtgcatacagagcaagttactcagatggaaaactgaaagctcctcctaaa
ccatgtgctggcaatcaagggacccagatcacggtggaggaccttttttacaacatagcc
acgaggagaaaagctttaaaaaatccaagtgaagaatatgggaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagtaaaaaaacaaggagagaca
gtagctgatgttaggacactacccaatgcctcaaccgtggacaatattcgctccatcttt
ggaaatgctgttagtcgagaactgatagaaattggatgtgaggataaaaccctagccttc
agaatgaatggttacatttccaatgcaaactactcggtgaagaagtgtatcttcttactc
tttatcaaccatcgtctggtagaatcaacttccttgagaaaagccatagaaacggtgtat
gcagcctatttgcccaaaaatacacacccattcctatacctcagtttagaaatcagtccc
cagaatgtggatgttaatgtgcaccccacaaagcacgaagttcacttcctgcatgaggag
agcatcctggagcgggtgcagcagcacattgagagcaagctcttgggctccaattcctcc
aggatgtacttcacccagactttgctaccaggactcgctggcccctctggggagatggtt
aaatccacaacaagtctgacctcctcttctacttctggaagtggtgataaggtctatgcc
caccagatggttcgtacagattcccgagaacagaagcttgatgcatttctgcagcctctg
agcaaaccactgtccagtcagccccaggccactgtcccagaggataaaacagatatttct
agtggcagggctaggcagcaagatgaggagatgcttgaactcccagctcctgctgaagtg
gctgccaaaaatcagatcctggagggggatacaacaaaggggacttcagaaatgtcagag
aagagaggacctacttccagcccaggcaatcccagaaagagacatcgggaagattctgat
gtggatatggtggaagatgattcccgaaaggacatgactgcagcctgtaccccccggaga
aggatcattaacctcaccagtgttttgagtctccaggaagaaattaatgagcgaggacat
gagattcttcgggagatgttgcataaccactccttcgtgggctgtgtgaatcctcagtgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccaagcttagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgtcctgaggttatcggag
ccagcaccgctctttgacctcgccatgcttgccttagatagtccagagagtggctggaca
gaggaagatggtcctaaagaaggacttgctgaatacattgttgagtttctgaagaagaag
gctgagatgcttgcagactatttctctttggaaattgatgaggaagggaacctgattgga
ttaccccttctgattgacaactatgtgccccctttggagggactgcctatcttcattctt
cgactagccactgaggtaaattgggacgaagaaaaggaatgttttgaaagcctcagtaaa
gagtgtgctatgttctactccatccggaagcagtacatatctgaggagtcgaccctctca
ggccagcagagtgaagtgcctggctccatttcagactcctggaagtggactgtggaacac
attgtctataaagccttgcgctcacacattctgcctcctaaacatttcacagaagatggt
aatatcctgcagcttgctaacctgcctgatctatacagagtctttgagaggtgttaa

DBGET integrated database retrieval system