KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028240Help
Entry
101028240         CDS       T04350                                 

Gene name
SMARCC2
Definition
(RefSeq) SWI/SNF complex subunit SMARCC2
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04714  Thermogenesis
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101028240 (SMARCC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101028240 (SMARCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101028240 (SMARCC2)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101028240 (SMARCC2)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     101028240 (SMARCC2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    101028240 (SMARCC2)
   PBAF complex
    101028240 (SMARCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding SWIRM Myb_DNA-bind_6 Chromo BRCT_2
Motif
Other DBs
NCBI-GeneID: 101028240
NCBI-ProteinID: XP_010348318
LinkDB All DBs
Position
Unknown
AA seq 1199 aa AA seqDB search
MGDSGQFIWGLFFFSFPLFSKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKL
PIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNC
LSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMK
RDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEED
YEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNA
KKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGT
MTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYN
SVHAIERRALPEFFNGKNKSKTPEMPCLPSPHRVHAFLEQWGLINYQVDAESRPTPMGPP
PTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSAS
QQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEM
YKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMS
TVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGL
ESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPK
KDEEKGKEGDSEKESEKSDGDPIGDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGE
GNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDR
EREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPA
GAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGA
VPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPS
IIPFGSLADSISINLPPPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPS
SLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgggagatagtggacaattcatctggggtctatttttcttttctttccctcttttttcc
aagtatatacaagctgaaccacccaccaacaagtccctgtctagcctggttgtgcagttg
ctacaatttcaggaagaagtttttggcaaacatgtcagcaatgcaccgctcactaaactg
ccgatcaaatgtttcctagatttcaaagctgggggctccttgtgccacattcttgcagct
gcctacaaattcaagagtgaccagggatggcggcgttacgatttccagaatccatcacgc
atggaccgcaatgtggaaatgtttatgaccattgagaagtccttggtgcagaataattgc
ttgtctcggcctaacatttttctgtgcccggaaattgagcccaaactactagggaaacta
aaggacattatcaagagacaccagggaacagtcactgaagataagaacaatgcctcccat
gttgtgtatcctgtcccggggaatctagaagaagaggaatgggtacgaccagtcatgaag
agggataagcaggttcttctgcactggggctactatcctgacagttatgacacgtggatc
ccagcgagtgaaattgaagcatctgtggaagatgctccaactcctgagaaacctaggaag
gttcatgcaaagtggatcctggacactgacaccttcaatgaatggatgaatgaggaagac
tatgaagtaaatgatgacaaaaaccctgtctcccgccgaaagaagatttcagccaagaca
ttgacagatgaggtgaacagcccagattcagatcgacgggacaagaaggggggaaactat
aagaagaggaagcgctccccatctccttcaccaaccccagaagcgaagaagaaaaatgct
aagaaaggtccctcaacaccttacactaagtcaaagcgtggtcacagagaagaggagcaa
gaagacctgacaaaggacatggacgagccctcaccagtccccaatgtagaagaggtgaca
cttcccaaaacagtcaacacaaagaaagactcagagtcagccccagtcaaaggcggcacc
atgactgacctggatgaacaggaagatgaaagcatggagacgacgggcaaggatgaggat
gagaacagtacaggaaacaagggggagcagaccaagaatccagatctgcatgaggacaac
gtgacggaacagacccaccacatcatcattcccagctatgcggcctggttcgactacaat
agcgttcatgccattgagcggagggctcttcctgagttcttcaacggcaagaacaagtcc
aagactccagagatgccgtgtctgccctctccacacagggtccatgccttcctagaacaa
tggggtcttattaactatcaggtggatgctgagagtcgaccaaccccaatggggcctccg
cctacctctcacttccatgtcttggctgacacaccatcagggctggtgcctctgcagccc
aagaccccgcagggccgccaggttgatgctgataccaaggctgggcgaaagggcaaagag
ctggatgacctggtgccagagacggctaagggcaagccagagctgcagacctctgcttcc
caacaaatgctcaactttcccgacaaaggcaaagagaaaccaacagacatgcaaaacttt
gggctgcgcacagacatgtacacaaaaaagaatgtcccctccaagagcaaagctgcagcc
agtgccactcgtgagtggacagaacaggaaaccctgcttctcctggaggcactggaaatg
tacaaagatgactggaacaaagtgtccgagcatgtgggaagccgcacacaggacgagtgc
atcttgcattttcttcgtcttcccattgaagacccatacctggaggactcagaggcctcc
ctaggccccctggcctaccaacccatccccttcagtcagtcgggcaaccctgttatgagc
actgttgccttcctggcctctgtcgtcgatccccgagtcgcctctgctgctgcaaagtca
gccctagaggagttctccaaaatgaaggaagaggtacccacggccttggtggaggcccat
gttcggaaagtggaagaagcagccaaagtaacaggcaaggcggaccctgcctttggtctg
gaaagcagtggcattgcaggaaccacctctgatgagcctgagcggattgaggagagtggg
aatgatgaggctcgagtggaaggccaggccacagatgagaagaaggagcccaaggaaccc
cgagaaggagggggtgctatagaggaggaagcaaaggagaaaaccagtgaggctcccaag
aaggatgaagagaaagggaaagaaggcgacagcgagaaggagtctgagaagagtgatgga
gacccaataggtgatcctgagaaggagaaggagccgaaagaagggcaggaggaagtgctg
aaggaagtggtggagtctgagggggaaaggaagacaaaggtggagcgggacattggcgag
ggcaacctctccaccgccgctgctgccgccctggccgccgctgcagtgaaagccaagcac
ttggctgctgttgaggaaaggaagatcaaatctttggtggccctgctggtggagacccag
atgaaaaagttggagatcaaacttcggcactttgaggagctggagactatcatggaccga
gagcgagaagcactggagtatcagaggcagcagctcctggccgacagacaagccttccac
atggagcagctgaagtatgcggagatgagggcccggcagcagcacttccaacagatgcac
caacaacagcagcagccaccgccagccctgcccccaggctcccagcctatccccccagcg
ggggctgctgggccacctgcagtccatggcttggctgtggctccagcctctgtagtccct
gctcctgctggcagtggggcccctccaggaagcttgggcccttctgaacagattgggcag
gcagggtcaactgcagggccacagcagcagcaaccagctggagccccccagcctggggca
gtcccaccaggggttcccccccctggaccccatggcccctcaccgttccccaaccaacaa
actcctccctcaatgatgccaggggcagtgccaggcagcgggcacccaggcgtggcgggt
aatgctcctttgggtttgccttttggcatgccgcctcctcctcctcctcctgctccatcc
atcatcccatttggtagtctagctgactccatcagtattaaccttccccctcctcctaac
ctgcatgggcatcaccaccatctcccgttcgccccgggcactctccccccacctaacctg
cctgtgtccatggcgaaccctctacatcctaacctgccggcgaccaccaccatgccatct
tccttgcctctcgggccggggctcggatccgccgcagcccaaagccctgccattgtggca
gctgttcagggcaacctcctgcccagtgccagcccactgccagacccaggcacccccctg
cctccagaccccacagccccgagcccaggcacggtcacccctgtgccacctccacagtga

DBGET integrated database retrieval system