KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028278
Entry
101028278         CDS       T04350                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04380  Osteoclast differentiation
sbq04714  Thermogenesis
sbq05016  Huntington disease
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101028278 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101028278 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101028278 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    101028278 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    101028278 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101028278 (PPARG)
   05202 Transcriptional misregulation in cancer
    101028278 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101028278 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101028278 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101028278 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101028278 (PPARG)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101028278 (PPARG)
Nuclear receptors [BR:sbq03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   101028278 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 101028278
NCBI-ProteinID: XP_003927097
LinkDB
Position
Unknown
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRADPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYSKPHEEASNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacacagagatgccattctggcccaccaactttgggatcagctccgtggatctc
tccgtaatggacgaccactctcactcctttgacatcaagcccttcactactgttgacttc
tccagcatttctactccacactatgaagacattccattcacaagagcagatccgatggtt
gcagattataagtatgacctgaaacttcaagagtaccaaagtgcaatcaaagtggagcct
gcatctccaccttattattctgagaagactcagctctacagtaagcctcatgaagaggct
tccaactccctcatggcaatcgaatgtcgtgtctgtggagataaagcttctgggttccac
tatggagttcatgcttgtgaaggatgcaagggtttcttccggaggacaatcagattgaag
cttatctatgacaggtgtgatcttaactgtcggatccacaaaaaaagtagaaataaatgt
cagtactgtcggtttcagaaatgccttgcagtagggatgtctcataatgccatcaggttt
gggcggatgccacaggccgagaaggagaagctgttggcggagatctccagtgatatcgac
cagctgaacccagagtccgctgacctccgggccctggcaaaacatttgtatgactcatac
ataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaagacaaca
gacaaatcaccatttgttatctatgacatgaattctttaatgatgggagaagataaaatc
aagttcaaacacatcaccccactgcaggagcagagcaaagaggtggccatccgcatcttt
cagggctgccagttccgctctgtggaggctgtgcaggagatcacagagtatgccaaaagc
attcctggttttgtaaatcttgacttgaacgaccaagtaactctcctcaaatatggagtc
cacgagatcatttacacaatgctggcctccttgatgaataaagatggggttctcatatcc
gagggccagggcttcatgacacgggagtttctaaagagcctgcgaaagccttttggtgac
tttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagatgacagt
gacttggcaatatttattgctgtcattattctcagtggagaccgcccaggtttgctgaat
gtgaagcccattgaagacatacaagacaacctgctacaagccctggagctccagctgaag
ctgaaccaccctgagtcctctcagctatttgccaagctgctccagaaaatgacagacctc
agacagattgtcacggaacacgtgcagctactgcaggtgatcaagaagacagagacggac
atgagtctgcaccccctcctgcaggagatttacaaggacttgtactag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036832
Entry
101036832         CDS       T04350                                 

Gene name
PAX8
Definition
(RefSeq) paired box protein Pax-8 isoform X1
  KO
K09293  paired box protein 8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04918  Thyroid hormone synthesis
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101036832 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036832 (PAX8)
   05202 Transcriptional misregulation in cancer
    101036832 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101036832 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101036832 (PAX8)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    101036832 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 HTH_38
Other DBs
NCBI-GeneID: 101036832
NCBI-ProteinID: XP_003942560
UniProt: A0A2K6SLB8
LinkDB
Position
Unknown
AA seq 456 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGGDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPAGASVPPFNAFPHAASVYGQ
FTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYS
EAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggcgggctgaaccagctgggaggggccttt
gtgaacggcagacccctgccagaagtggtccgccagcgcattgtagacctggcccaccaa
ggcgtgaggccctgtgacatctctcgccagctccgcgtcagccatggctgcgtcagcaag
atcctgggcaggtactacgagactgggagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgtcagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaacagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagccctggacacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcggtgacaagaggaaaatggatgac
agtgaccaggatagctgccggctgagcattgactcacagagcagcagcagtggaccccga
aagcaccttcgcacggacgccttcagccagcaccaccttgagccactcgagtgcccattt
gagcggcagcactaccccgaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccactgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgcccttggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcattcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtccca
gccggtgcctcggtcccgcccttcaatgcctttccccatgctgcctccgtgtacgggcag
ttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcccggatac
ccaccccacatccccacaagcggacagggcagctatgcctcctctgccatcgcaggcatg
gtggcaggaagtgaatactctggcaatgcctatggccacaccccctactcctcctacagc
gaggcctggcgcttccccaactccagcttgctgagttccccatattattacagttccaca
tcgaggccgagcgcgccacccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system