KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028427
Entry
101028427         CDS       T04350                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04151  PI3K-Akt signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  Jak-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq04940  Type I diabetes mellitus
sbq05135  Yersinia infection
sbq05142  Chagas disease (American trypanosomiasis)
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease (IBD)
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101028427 (IL2)
   04151 PI3K-Akt signaling pathway
    101028427 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101028427 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101028427 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101028427 (IL2)
   04660 T cell receptor signaling pathway
    101028427 (IL2)
   04658 Th1 and Th2 cell differentiation
    101028427 (IL2)
   04659 Th17 cell differentiation
    101028427 (IL2)
   04672 Intestinal immune network for IgA production
    101028427 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101028427 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101028427 (IL2)
   05321 Inflammatory bowel disease (IBD)
    101028427 (IL2)
   05330 Allograft rejection
    101028427 (IL2)
   05332 Graft-versus-host disease
    101028427 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101028427 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101028427 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101028427 (IL2)
   05162 Measles
    101028427 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101028427 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101028427 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101028427 (IL2)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101028427 (IL2)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Haparin
  Cytokines
   101028427 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 101028427
NCBI-ProteinID: XP_003936285
UniProt: A0A2K6TDD1
LinkDB
Position
Unknown
AA seq 154 aa
MYRMQLLSCIALSLALITNSAPTSSSTKKTQLQLEHLLLDLQMLLNGINNYKNPKLTRML
TFKFYLPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTRDIISNINVLVLELKGS
ETTFTCEYDDDTATIIEFLNGWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcactcatcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggac
ttacagatgcttttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acctttaagttttacctgcctaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcagagcaaaaactttcactta
agagataccagggatataatcagcaatatcaatgtactagttctggaactaaagggatct
gaaacaactttcacatgtgaatatgatgatgacacagcaaccattatagaatttttgaat
ggatggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system