KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028427
Entry
101028427         CDS       T04350                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04151  PI3K-Akt signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq04940  Type I diabetes mellitus
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101028427 (IL2)
   04151 PI3K-Akt signaling pathway
    101028427 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101028427 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101028427 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101028427 (IL2)
   04660 T cell receptor signaling pathway
    101028427 (IL2)
   04658 Th1 and Th2 cell differentiation
    101028427 (IL2)
   04659 Th17 cell differentiation
    101028427 (IL2)
   04672 Intestinal immune network for IgA production
    101028427 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101028427 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101028427 (IL2)
   05321 Inflammatory bowel disease
    101028427 (IL2)
   05330 Allograft rejection
    101028427 (IL2)
   05332 Graft-versus-host disease
    101028427 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101028427 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101028427 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101028427 (IL2)
   05171 Coronavirus disease - COVID-19
    101028427 (IL2)
   05162 Measles
    101028427 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101028427 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101028427 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101028427 (IL2)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101028427 (IL2)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101028427 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 101028427
NCBI-ProteinID: XP_003936285
UniProt: A0A2K6TDD1
LinkDB
Position
Unknown
AA seq 154 aa
MYRMQLLSCIALSLALITNSAPTSSSTKKTQLQLEHLLLDLQMLLNGINNYKNPKLTRML
TFKFYLPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTRDIISNINVLVLELKGS
ETTFTCEYDDDTATIIEFLNGWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcactcatcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggac
ttacagatgcttttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acctttaagttttacctgcctaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcagagcaaaaactttcactta
agagataccagggatataatcagcaatatcaatgtactagttctggaactaaagggatct
gaaacaactttcacatgtgaatatgatgatgacacagcaaccattatagaatttttgaat
ggatggattaccttttgtcaaagcatcatctcaacactgacttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029390
Entry
101029390         CDS       T04350                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101029390 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101029390 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101029390 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101029390 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101029390 (IL21)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101029390 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 101029390
NCBI-ProteinID: XP_003936286
UniProt: A0A2K6UA04
LinkDB
Position
Unknown
AA seq 161 aa
MRSSPGNMERIVICLIVILGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFL
PAPEDVETNCEWSAFSCFQKAQLKSANTGDNERIINVSIKKLKRKPPSTKAERRQKHRLT
CPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggatagtcatctgtctgatagtcatcttgggt
acattggtccataaatcaagttcccaaggtcaagatcgccacatgattagaatgcgtcaa
cttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccccgaatttctg
ccagctccagaagatgtagagacaaactgtgagtggtcagctttttcatgttttcagaag
gcccaactaaagtccgcaaatacaggagacaatgaaaggataatcaatgtatcaattaaa
aagctgaagaggaaaccaccttccacaaaagcagagagaagacagaaacacagactaaca
tgcccttcatgtgattcttacgagaaaaaaccacccaaagaattcctagaaagattcaaa
tcacttctccaaaagatgattcatcaacatctctcctctagaacacatggaagtgaagat
tcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032182
Entry
101032182         CDS       T04350                                 

Gene name
IFNL1
Definition
(RefSeq) interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032182 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032182 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032182 (IFNL1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032182 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101032182
NCBI-ProteinID: XP_003943181
LinkDB
Position
Unknown
AA seq 191 aa
MAAVWIVMLVILVLGLAVTGSVPISKPITTGKGCNIDRYKSLPPQELESFKKARDALEES
FKLKDWNCTSPVFPRNWDLRLLQVRERPVALEAELALTLEVLEAAADNDMALGDVLDRPL
HTLHHVLSQLRACVQPQPTAGPRPRGHLHHWLHRLQEAPKKESPGCLKASVTFNLFRLLI
RDLHCVASGDL
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctgcagtttggatcgtcatgctggtgattttggtgttaggtttggctgtgacaggc
tctgtccccatttccaagcccatcactactgggaagggctgcaacattgacaggtacaaa
tctctgccaccgcaggagctagagagcttcaagaaggccagggatgccttggaagagtca
ttcaagctgaaagactggaattgcacctctcctgtcttccccaggaattgggacctgcgg
ctgctccaggtgagggagcgccccgtggccttggaggctgagctggccctgacgctggag
gttctggaggccgccgctgacaatgacatggccctgggtgacgtcctggaccggcccctt
cacaccctgcaccacgtcctctcccagctccgggcctgtgtccagcctcagcccacggca
gggcccagaccccggggccacctccaccattggctgcaccggctccaggaggccccgaaa
aaggagtcccctggctgcctcaaggcctctgtcaccttcaacctcttccgactcctcata
cgggacctgcattgtgtcgccagcggcgacctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032308
Entry
101032308         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032308
   04151 PI3K-Akt signaling pathway
    101032308
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032308
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032308
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032308
   04621 NOD-like receptor signaling pathway
    101032308
   04622 RIG-I-like receptor signaling pathway
    101032308
   04623 Cytosolic DNA-sensing pathway
    101032308
   04650 Natural killer cell mediated cytotoxicity
    101032308
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032308
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032308
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032308
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032308
   05161 Hepatitis B
    101032308
   05160 Hepatitis C
    101032308
   05171 Coronavirus disease - COVID-19
    101032308
   05164 Influenza A
    101032308
   05162 Measles
    101032308
   05168 Herpes simplex virus 1 infection
    101032308
   05163 Human cytomegalovirus infection
    101032308
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032308
   05169 Epstein-Barr virus infection
    101032308
   05165 Human papillomavirus infection
    101032308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032308
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032308
SSDB
Motif
Pfam: Interferon DUF4164 DDHD UPF0058
Other DBs
NCBI-GeneID: 101032308
NCBI-ProteinID: XP_003928165
LinkDB
Position
Unknown
AA seq 185 aa
MMVLPLYLLVALLVLSYKSFSSLGCDLPQNYSLGNRRALVFLAQMRRISPFSCLKDRHDF
GFPPKEFDGSKLQKAQAIFVLHEMIQQIFNLFSTKDSSAAWDETLLEKFYTELHQQLNDL
EACVMQKAGVTETPVMYEDFILAVRKYFQRIALYLTEKKHSPCAWEVVRAEIMRSFSLLT
NLQKR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgatggtcttgcccttgtatttactggtggcccttctggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaactacagcttgggtaacaggagggccttggta
tttctggcacaaatgagaagaatctctcctttttcctgcctgaaggacagacatgacttt
ggattccccccgaaggagtttgatggcagcaagctccagaaggcgcaagccatttttgtc
ctccatgagatgatccagcagatcttcaacctcttcagcacaaaggactcatctgcagct
tgggacgagaccctccttgaaaaattctacactgaacttcaccagcagctgaatgatcta
gaagcctgtgtgatgcagaaggcaggggtgacagagactcccgtgatgtacgaggacttc
attctggctgtgaggaaatacttccaaagaattgctctatatctgacagagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgacc
aacttgcaaaaaagatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032622
Entry
101032622         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032622
   04151 PI3K-Akt signaling pathway
    101032622
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032622
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032622
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032622
   04621 NOD-like receptor signaling pathway
    101032622
   04622 RIG-I-like receptor signaling pathway
    101032622
   04623 Cytosolic DNA-sensing pathway
    101032622
   04650 Natural killer cell mediated cytotoxicity
    101032622
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032622
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032622
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032622
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032622
   05161 Hepatitis B
    101032622
   05160 Hepatitis C
    101032622
   05171 Coronavirus disease - COVID-19
    101032622
   05164 Influenza A
    101032622
   05162 Measles
    101032622
   05168 Herpes simplex virus 1 infection
    101032622
   05163 Human cytomegalovirus infection
    101032622
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032622
   05169 Epstein-Barr virus infection
    101032622
   05165 Human papillomavirus infection
    101032622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032622
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032622
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 101032622
NCBI-ProteinID: XP_003928166
LinkDB
Position
Unknown
AA seq 189 aa
MALTFPFLVALVLLSYKSSCSMGCDLPQTHSLGNRRTLMLLAQMRRISPFSCLKDRHDFE
FPQEEFDGSQLQKARAIFVLHEMIQQTFNLFSTKDSSAAWDETLLDKFYTELYQQLNELE
ACVMQEVGVTDTPLMNEDSILTVRKYFQRITLYLKEKKYSACAWEVVRAEIMRSFSSSTN
LQKALRSKK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgacctttcctttcctggtggccctcgtgctgctcagctacaagtcaagctgc
tctatgggctgtgatctgcctcaaacccacagcctgggtaacaggagaactttgatgctt
ctggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttgatggcagccagctccagaaggctagagccatttttgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaagactcatctgctgcttgg
gatgagaccctcctagacaaattctacactgaactttaccagcagctgaatgaattggaa
gcctgtgtgatgcaggaggtgggggtgacagatactcccctgatgaatgaggactccatc
ctgactgtgaggaaatatttccaaagaatcactctctatctgaaagagaagaaatacagc
gcttgtgcctgggaggttgtcagagcagaaataatgagatctttttcttcatcaacaaac
ttgcaaaaagctttaagaagtaagaaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032943
Entry
101032943         CDS       T04350                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032943 (IFNA13)
   04151 PI3K-Akt signaling pathway
    101032943 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032943 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032943 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032943 (IFNA13)
   04621 NOD-like receptor signaling pathway
    101032943 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    101032943 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    101032943 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    101032943 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032943 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032943 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032943 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032943 (IFNA13)
   05161 Hepatitis B
    101032943 (IFNA13)
   05160 Hepatitis C
    101032943 (IFNA13)
   05171 Coronavirus disease - COVID-19
    101032943 (IFNA13)
   05164 Influenza A
    101032943 (IFNA13)
   05162 Measles
    101032943 (IFNA13)
   05168 Herpes simplex virus 1 infection
    101032943 (IFNA13)
   05163 Human cytomegalovirus infection
    101032943 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032943 (IFNA13)
   05169 Epstein-Barr virus infection
    101032943 (IFNA13)
   05165 Human papillomavirus infection
    101032943 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032943 (IFNA13)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032943 (IFNA13)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101032943
NCBI-ProteinID: XP_003928167
LinkDB
Position
Unknown
AA seq 189 aa
MALPFPSLMALVVLSCKISCYLTCDLPQIHSLDNRRTMMLLAQMMRIFPFSCWKDRHDFG
FPQEEFDGNQFQKAPAIFVLHEMIQQTFNLFTTEDSSAAWDKDLLDELCTELYRQLNDLE
ACVMEEERAGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRVEIMRSFSLSKN
LLERLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttccttcactgatggccctggtggtgctcagctgcaagataagctgc
tatctgacctgtgatctgcctcagatccatagcctggataacaggaggaccatgatgctc
ctggcacaaatgatgagaatctttcctttttcctgttggaaggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagtttcagaaggcaccagccatctttgtcctc
catgagatgatccagcagacctttaacctctttaccacagaagactcatctgctgcttgg
gataaggacctcctagatgaactctgcactgaactctaccggcagctaaatgacttggaa
gcctgtgtgatggaggaggagagggcgggagaaactcccctgatgaatgtggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaagttgtcagagtagaaatcatgagatccttctctttatcaaaaaac
ttactagaaagattaaggaggaaggattaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033464
Entry
101033464         CDS       T04350                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03050  Proteasome
sbq04060  Cytokine-cytokine receptor interaction
sbq04066  HIF-1 signaling pathway
sbq04217  Necroptosis
sbq04350  TGF-beta signaling pathway
sbq04380  Osteoclast differentiation
sbq04612  Antigen processing and presentation
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04940  Type I diabetes mellitus
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05200  Pathways in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
sbq05322  Systemic lupus erythematosus
sbq05323  Rheumatoid arthritis
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101033464 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101033464 (IFNG)
   04630 JAK-STAT signaling pathway
    101033464 (IFNG)
   04066 HIF-1 signaling pathway
    101033464 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101033464 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101033464 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101033464 (IFNG)
   04612 Antigen processing and presentation
    101033464 (IFNG)
   04660 T cell receptor signaling pathway
    101033464 (IFNG)
   04658 Th1 and Th2 cell differentiation
    101033464 (IFNG)
   04659 Th17 cell differentiation
    101033464 (IFNG)
   04657 IL-17 signaling pathway
    101033464 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101033464 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033464 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101033464 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101033464 (IFNG)
   05323 Rheumatoid arthritis
    101033464 (IFNG)
   05321 Inflammatory bowel disease
    101033464 (IFNG)
   05330 Allograft rejection
    101033464 (IFNG)
   05332 Graft-versus-host disease
    101033464 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101033464 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101033464 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101033464 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101033464 (IFNG)
   05164 Influenza A
    101033464 (IFNG)
   05168 Herpes simplex virus 1 infection
    101033464 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101033464 (IFNG)
   05144 Malaria
    101033464 (IFNG)
   05145 Toxoplasmosis
    101033464 (IFNG)
   05140 Leishmaniasis
    101033464 (IFNG)
   05142 Chagas disease
    101033464 (IFNG)
   05143 African trypanosomiasis
    101033464 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sbq03051]
    101033464 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101033464 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101033464 (IFNG)
Proteasome [BR:sbq03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101033464 (IFNG)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101033464 (IFNG)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101033464 (IFNG)
SSDB
Motif
Pfam: IFN-gamma DUF5390
Other DBs
NCBI-GeneID: 101033464
NCBI-ProteinID: XP_003926592
UniProt: A0A2K6UZJ8
LinkDB
Position
Unknown
AA seq 166 aa
MKYTSYFLAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDSDVADNGTLFLNILRTWR
EEGDRKIMQSQIISFYFKLFKNFKDNQSIQKSMETIKEDMNVKFFNSNKRKQDDFERLTN
YSVTDLNVQRKAIHELIQVMAELSPAPKIGKRKRSQTLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatttcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaatctgaagaaatattttaatgca
ggtgattcagatgtagcagataatggaactcttttcttaaacattttgaggacttggaga
gaggagggtgacagaaaaataatgcagagccagattatctccttttacttcaaacttttt
aaaaactttaaagacaaccagagcatccagaagagtatggagaccatcaaggaagacatg
aatgtcaagtttttcaacagcaataaaaggaaacaggatgactttgaaaggctgactaat
tattcggtaaccgacttgaatgtccagcgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcaccagcacctaaaatagggaagcgaaaaaggagtcagacgctgtttcga
ggtcgaagagcgtcccaataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034093
Entry
101034093         CDS       T04350                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034093 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034093 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101034093 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101034093 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034093 (IL22)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101034093 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 101034093
NCBI-ProteinID: XP_003926594
UniProt: A0A2K6UL79
LinkDB
Position
Unknown
AA seq 179 aa
MAALQKSVSSFLMGSLATSYLLLLALSVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDIRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVS
FLARLSNRLSTCYIEGDDLHIQRNVQNLKDTVKKLGESGEIKAIGELDLLFMSLRNACV
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggtctctggccaccagctac
ctccttctcttggccctctcggtgcagggaggagcagctgcacccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacattcgtctcattggggagaaactattc
cgcggagtcagtatgagcgagcgctgctatctgatgaagcaggtgctgaactttaccctt
gaagaagtgctgctccctcagtctgataggttccagccttatatgcaggaggtggtgtcc
ttcctggccaggctcagcaacaggctaagtacatgttatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaatctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgtgtttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034105
Entry
101034105         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034105
   04151 PI3K-Akt signaling pathway
    101034105
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034105
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034105
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034105
   04621 NOD-like receptor signaling pathway
    101034105
   04622 RIG-I-like receptor signaling pathway
    101034105
   04623 Cytosolic DNA-sensing pathway
    101034105
   04650 Natural killer cell mediated cytotoxicity
    101034105
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034105
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034105
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034105
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034105
   05161 Hepatitis B
    101034105
   05160 Hepatitis C
    101034105
   05171 Coronavirus disease - COVID-19
    101034105
   05164 Influenza A
    101034105
   05162 Measles
    101034105
   05168 Herpes simplex virus 1 infection
    101034105
   05163 Human cytomegalovirus infection
    101034105
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034105
   05169 Epstein-Barr virus infection
    101034105
   05165 Human papillomavirus infection
    101034105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034105
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034105
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 101034105
NCBI-ProteinID: XP_003928170
LinkDB
Position
Unknown
AA seq 190 aa
MMVLSLHLLVALLVLSYKSFSSLGCDLPQNYSLGNRRALVFLAQMRRISPFSCLKDRHDF
GFPQKEFDGSKLQKAQAIFVLHEMVQQTFNLFSTKDSSAAWDETLLEKFYTELHQQLNDL
EACAMQKVGVTETPLMYEDFILAVRKYFQRIILYLIEKKHSPCAWEVVRAEIMRSFSLLT
NLQKRSKTKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggtcttgtccttacatttactggtggcccttctggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaactacagcttgggtaacaggagggccttggta
ttcctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgacttt
ggattcccccaaaaggagtttgatggcagcaagctccagaaggctcaggccatttttgtc
ctccatgagatggtccagcagaccttcaacctcttcagtacaaaggactcatctgcagct
tgggacgagaccctccttgaaaaattctacactgaacttcaccagcagctgaatgatctg
gaagcctgtgcaatgcagaaggtaggggtgacagagactcccctgatgtacgaggacttc
attttggctgtgaggaaatacttccaaagaatcattctatacctgatagagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgacc
aacttgcaaaaaagatcgaagactaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034416
Entry
101034416         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034416
   04151 PI3K-Akt signaling pathway
    101034416
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034416
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034416
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034416
   04621 NOD-like receptor signaling pathway
    101034416
   04622 RIG-I-like receptor signaling pathway
    101034416
   04623 Cytosolic DNA-sensing pathway
    101034416
   04650 Natural killer cell mediated cytotoxicity
    101034416
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034416
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034416
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034416
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034416
   05161 Hepatitis B
    101034416
   05160 Hepatitis C
    101034416
   05171 Coronavirus disease - COVID-19
    101034416
   05164 Influenza A
    101034416
   05162 Measles
    101034416
   05168 Herpes simplex virus 1 infection
    101034416
   05163 Human cytomegalovirus infection
    101034416
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034416
   05169 Epstein-Barr virus infection
    101034416
   05165 Human papillomavirus infection
    101034416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034416
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034416
SSDB
Motif
Pfam: Interferon CBF DUF4164
Other DBs
NCBI-GeneID: 101034416
NCBI-ProteinID: XP_003928171
LinkDB
Position
Unknown
AA seq 189 aa
MALPFTLLMALVVLSCKSICSLGCDLPQAHSLNNRRALILLAQMRRISPFSCLKDRQDFV
FPQEVFDGDHFQKAQAIFILHEMIQQTFNLFSTKDSSATWDATLLDKFYTELYEQLNDLE
TCVMQRIGVEETPLAYEDSILAVRKYFQRITLYLTEKKHSLCAWEVVRAEIMRSFSLLTD
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttactttactgatggccctagtggtgctcagctgcaagtccatctgc
tctctgggctgtgatctgcctcaggcccatagcctgaataacagaagggccttgatactc
ctggcacaaatgaggagaatctctcctttctcttgcctgaaggacagacaggactttgtt
ttccctcaagaggtgtttgatggtgaccacttccagaaggctcaagctatcttcatcctc
catgagatgatccagcagaccttcaacctctttagcacaaaggactcatccgctacttgg
gatgcaacccttttagataaattttacactgaactttacgagcagctgaatgacttggaa
acctgtgtgatgcagaggattggagtggaagagactcccttggcgtatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgacagagaagaaacacagc
ctttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgaccgac
ttgcaagaaagattaagaaggaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034582
Entry
101034582         CDS       T04350                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05133  Pertussis
sbq05152  Tuberculosis
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034582 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034582 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101034582 (IL23A)
   04659 Th17 cell differentiation
    101034582 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034582 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101034582 (IL23A)
   05321 Inflammatory bowel disease
    101034582 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101034582 (IL23A)
   05152 Tuberculosis
    101034582 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034582 (IL23A)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101034582 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 101034582
NCBI-ProteinID: XP_003939375
UniProt: A0A2K6T1T5
LinkDB
Position
Unknown
AA seq 189 aa
MLGSRAVMLLLLLPWMAQGRAVPGGSSPAWAQCQQLSQKLCMLAWSAHPLVGHMHLREEG
DEETTNHAPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHSETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctactgccctggatggctcagggcagg
gctgtgcctgggggcagcagccctgcctgggctcaatgccagcagctctcacagaagctc
tgcatgctggcctggagtgcacatccactagtgggacacatgcatctaagagaagaggga
gatgaagagactacaaaccatgctccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagcccc
gtgggccagcttcatgcctccctacttggcctcagccaactcctgcagcctgagggtcac
cactcggagactcagcagattccaagccccagtcccagccagccatggcagcgcctcctt
ctccgattcaaaatccttcgcagcctccaggcctttgtggctgtagctgcccgggttttt
gcccatggagcggcaaccctgagtccctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034728
Entry
101034728         CDS       T04350                                 

Gene name
IFNA21
Definition
(RefSeq) interferon alpha-21
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034728 (IFNA21)
   04151 PI3K-Akt signaling pathway
    101034728 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034728 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034728 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034728 (IFNA21)
   04621 NOD-like receptor signaling pathway
    101034728 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    101034728 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    101034728 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    101034728 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034728 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034728 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034728 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034728 (IFNA21)
   05161 Hepatitis B
    101034728 (IFNA21)
   05160 Hepatitis C
    101034728 (IFNA21)
   05171 Coronavirus disease - COVID-19
    101034728 (IFNA21)
   05164 Influenza A
    101034728 (IFNA21)
   05162 Measles
    101034728 (IFNA21)
   05168 Herpes simplex virus 1 infection
    101034728 (IFNA21)
   05163 Human cytomegalovirus infection
    101034728 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034728 (IFNA21)
   05169 Epstein-Barr virus infection
    101034728 (IFNA21)
   05165 Human papillomavirus infection
    101034728 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034728 (IFNA21)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034728 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101034728
NCBI-ProteinID: XP_003928172
LinkDB
Position
Unknown
AA seq 189 aa
MALSFSLLMTMVVLSCKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRSDFE
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKASYAAWEQSLLEKFSNELYQQLNDLE
ACVIQEVGVEETPLMNADSILAVRKYFQRITLYLTKKKYSPCGWEVVRAEIMRSFSLSTN
LRERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctttgtccttttctttactgatgaccatggtggtgctcagctgcaaatccatctgc
tctcttggctgtgatctgcctcagacccacagcctgggtaacaggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagaagtgactttgaa
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagactttcaatctcttcagcacaaaagcctcatatgctgcttgg
gaacagagtcttctagagaaattttccaatgaactttaccagcagttgaatgatctggaa
gcctgtgtaatacaggaggttggggtggaagagactcccctgatgaatgcagactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctgacaaagaagaaatacagc
ccttgtggctgggaggtggtcagagcagaaatcatgagatccttctctttatcaacaaac
ttgcgagaaagattaaggaggaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034757
Entry
101034757         CDS       T04350                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01523  Antifolate resistance
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq04659  Th17 cell differentiation
sbq04668  TNF signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05010  Alzheimer disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
sbq05332  Graft-versus-host disease
sbq05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034757 (IL6)
   04668 TNF signaling pathway
    101034757 (IL6)
   04066 HIF-1 signaling pathway
    101034757 (IL6)
   04068 FoxO signaling pathway
    101034757 (IL6)
   04151 PI3K-Akt signaling pathway
    101034757 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034757 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101034757 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101034757 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101034757 (IL6)
   04620 Toll-like receptor signaling pathway
    101034757 (IL6)
   04621 NOD-like receptor signaling pathway
    101034757 (IL6)
   04623 Cytosolic DNA-sensing pathway
    101034757 (IL6)
   04625 C-type lectin receptor signaling pathway
    101034757 (IL6)
   04659 Th17 cell differentiation
    101034757 (IL6)
   04657 IL-17 signaling pathway
    101034757 (IL6)
   04672 Intestinal immune network for IgA production
    101034757 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034757 (IL6)
   05202 Transcriptional misregulation in cancer
    101034757 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101034757 (IL6)
   05321 Inflammatory bowel disease
    101034757 (IL6)
   05332 Graft-versus-host disease
    101034757 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034757 (IL6)
   05020 Prion disease
    101034757 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    101034757 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101034757 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101034757 (IL6)
   04931 Insulin resistance
    101034757 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101034757 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034757 (IL6)
   05135 Yersinia infection
    101034757 (IL6)
   05133 Pertussis
    101034757 (IL6)
   05134 Legionellosis
    101034757 (IL6)
   05152 Tuberculosis
    101034757 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034757 (IL6)
   05161 Hepatitis B
    101034757 (IL6)
   05171 Coronavirus disease - COVID-19
    101034757 (IL6)
   05164 Influenza A
    101034757 (IL6)
   05162 Measles
    101034757 (IL6)
   05168 Herpes simplex virus 1 infection
    101034757 (IL6)
   05163 Human cytomegalovirus infection
    101034757 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034757 (IL6)
   05169 Epstein-Barr virus infection
    101034757 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101034757 (IL6)
   05144 Malaria
    101034757 (IL6)
   05142 Chagas disease
    101034757 (IL6)
   05143 African trypanosomiasis
    101034757 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101034757 (IL6)
   01523 Antifolate resistance
    101034757 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034757 (IL6)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101034757 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF
Other DBs
NCBI-GeneID: 101034757
NCBI-ProteinID: XP_003935160
UniProt: A0A2K6T464
LinkDB
Position
Unknown
AA seq 212 aa
MNSLSTSAFRPVAFSLGLLLVMPAAFPAPVTLGEDSKEVAAPNRQLLTSTERIDKHIWYI
LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL
EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQRKAKNLSAIATPDPATNASLLTKLQ
AQDQWLQGVTTHLILRSFKEFLQCSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactctctctccacaagcgccttcagaccagttgccttctccctggggctgctcctg
gtgatgcctgctgccttccctgccccagtaaccctgggagaagattccaaagaggtagcc
gccccaaaccgacagctactcacctccacagaacgaattgacaaacacatttggtacatc
ctcgacggcatctcagccttgagaaaggagatatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggcagaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctgctgaaaatcaccactggtcttttg
gagtttgaagtatacctagagtacctccagaacaggtttgagagtagcaaggaacaagct
ggagctgtgcagatgagtacaaaaggcctgatccagtcactgcagagaaaggcaaagaat
ctaagtgcaatagccacccctgacccagccacaaatgccagcctgctgacgaagctgcag
gcacaggaccagtggctgcagggcgtgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagtgcagtctgcgggctctgcggcaaatgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034825
Entry
101034825         CDS       T04350                                 

Gene name
IFNL3
Definition
(RefSeq) interferon lambda-3
  KO
K22669  interferon lambda 2/3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034825 (IFNL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034825 (IFNL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034825 (IFNL3)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034825 (IFNL3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 101034825
NCBI-ProteinID: XP_010329266
UniProt: A0A2K6TAG8
LinkDB
Position
Unknown
AA seq 200 aa
MKRGMSRGCMAVLVLMATVLTVTGAVPVTRPPRALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPVALEAELALTLEVLEATADNDMALG
DVLDRPLHTLHHVLSQLRACVQPQPTAGPRPWGRLHHWLHRLQEAPKKESSGCLEASVTF
NLFRLLTRDLKCVASGDLCA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaacgaggcatgagcaggggctgcatggcagtgctggtgctgatggccacagtgctg
actgtcactggagcagttcctgtcaccaggccccccagggccctcccggatgcaaggggc
tgccacatagcccagttcaagtctctgtccccacaggagctgcaagcctttaagagagcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccgtggccttggaggct
gagctggccctgacgctggaggttctggaggccaccgctgacaatgacatggccctgggt
gacgtcctggaccggccccttcacaccctgcaccacgtcctctcccagctccgggcctgt
gtccagcctcagcccacggcagggcccaggccctggggtcgcctccaccactggctgcac
cggctccaggaggccccaaaaaaggagtcctctggctgcctggaggcctctgtcaccttc
aacctcttccgcctcctcacgcgggacctgaaatgcgtcgccagcggggacctgtgtgcc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035047
Entry
101035047         CDS       T04350                                 

Gene name
IFNW1
Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04622  RIG-I-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035047 (IFNW1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035047 (IFNW1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101035047 (IFNW1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101035047 (IFNW1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101035047 (IFNW1)
SSDB
Motif
Pfam: Interferon CDT1_C Ric8
Other DBs
NCBI-GeneID: 101035047
NCBI-ProteinID: XP_003928173
LinkDB
Position
Unknown
AA seq 195 aa
MAHLFPLLVALVVTSYSPVGSLACDLAQNHGQLNRNILVLLHQMRRISPFLCLKDRRDFS
FPQEMVEGSQVQKAQAMSVLHETLQQIFNLFHTEHSSAAWNTTLLDQLHAGLHQQLAHLE
TCLVQVMGEGESAGAIRSPALTLRRYFRGIQVYLKEKKYSDCAWEVVRVEILRSLFLSTN
LQERLRSKDGNLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggctcacctgttccctctactggtggctctagtggtgaccagctatagccctgttgga
tctctggcctgtgatctggctcagaaccatggccaacttaacaggaacatcttggtgctt
ctacaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaagagacttcagc
ttcccccaggagatggtggaagggagccaggtgcagaaggcccaggccatgtctgttctc
catgagacgctgcagcagatcttcaacctcttccacacagagcactcctctgctgcctgg
aacacgactcttttagaccaactccacgctggacttcatcagcaactggcacacctggag
acctgcttggtgcaggtaatgggagaaggagaatctgctggggcgattaggagccctgca
ctgaccttgaggaggtacttccggggaatccaggtctacctgaaagagaagaaatacagt
gactgtgcctgggaagttgtcagagtggaaatcttgagatccttgttcttatcaacaaac
ttgcaagaaagattgagaagtaaagatggaaacctcggctcatcttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035681
Entry
101035681         CDS       T04350                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04668  TNF signaling pathway
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035681 (IFNB1)
   04668 TNF signaling pathway
    101035681 (IFNB1)
   04151 PI3K-Akt signaling pathway
    101035681 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035681 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101035681 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101035681 (IFNB1)
   04621 NOD-like receptor signaling pathway
    101035681 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    101035681 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    101035681 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    101035681 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101035681 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101035681 (IFNB1)
   05152 Tuberculosis
    101035681 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101035681 (IFNB1)
   05161 Hepatitis B
    101035681 (IFNB1)
   05160 Hepatitis C
    101035681 (IFNB1)
   05171 Coronavirus disease - COVID-19
    101035681 (IFNB1)
   05164 Influenza A
    101035681 (IFNB1)
   05162 Measles
    101035681 (IFNB1)
   05168 Herpes simplex virus 1 infection
    101035681 (IFNB1)
   05163 Human cytomegalovirus infection
    101035681 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035681 (IFNB1)
   05169 Epstein-Barr virus infection
    101035681 (IFNB1)
   05165 Human papillomavirus infection
    101035681 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101035681 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101035681 (IFNB1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101035681 (IFNB1)
SSDB
Motif
Pfam: Interferon MetOD1
Other DBs
NCBI-GeneID: 101035681
NCBI-ProteinID: XP_003928175
LinkDB
Position
Unknown
AA seq 185 aa
MTHKCLLQIALLLCFSTTAISMSYNLLGFLQRRSNFQSQKLLRQLNGRLEYCLKDRMDFE
IPKEITQPQRLQKEDVALIVYEMLQNIFTIFNRDFSRTGWNKTIVENFLANVYQHIEHLK
TILKEKWEKKEFTREKSMSSLHLKRYYGRILHYLMAKEYSHCAWTIVSAEILRNFYFIDR
LTGYL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgacccacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctatt
tccatgagctacaacttacttggattcctacaaagaagaagcaattttcagagccagaag
ctcctacggcaactgaatggaaggcttgaatattgcctcaaggacaggatggactttgag
atccctaaggagatcacacaaccgcagcggctccagaaggaggacgtggcattaatcgtc
tatgagatgctccagaacatttttactattttcaatagagatttctctaggactggctgg
aataagactattgttgagaacttccttgctaatgtctatcagcacatagaacatttgaag
acaatcctgaaagaaaaatgggagaaaaaagaattcaccagggaaaaatccatgagcagt
ctacacctgaaaagatattatgggaggattctgcattacctgatggccaaggagtacagc
cactgtgcctggaccatagtcagtgcggaaatcctcaggaacttttactttattgacaga
cttacaggttacctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038267
Entry
101038267         CDS       T04350                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05140  Leishmaniasis
sbq05200  Pathways in cancer
sbq05310  Asthma
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038267 (IL4)
   04151 PI3K-Akt signaling pathway
    101038267 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038267 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101038267 (IL4)
   04660 T cell receptor signaling pathway
    101038267 (IL4)
   04658 Th1 and Th2 cell differentiation
    101038267 (IL4)
   04659 Th17 cell differentiation
    101038267 (IL4)
   04657 IL-17 signaling pathway
    101038267 (IL4)
   04664 Fc epsilon RI signaling pathway
    101038267 (IL4)
   04672 Intestinal immune network for IgA production
    101038267 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038267 (IL4)
  09163 Immune disease
   05310 Asthma
    101038267 (IL4)
   05320 Autoimmune thyroid disease
    101038267 (IL4)
   05321 Inflammatory bowel disease
    101038267 (IL4)
   05330 Allograft rejection
    101038267 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101038267 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101038267 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101038267 (IL4)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101038267 (IL4)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101038267 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3 Retrotran_gag_2
Other DBs
NCBI-GeneID: 101038267
NCBI-ProteinID: XP_003920654
LinkDB
Position
Unknown
AA seq 151 aa
MGLTSQLLPALFFLLACAGNFVHGHNCDVALEEIIKTLNIVTEQKTLCTELTVMDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQHFHSHKQLIRSLKRLDRNLCSLAGL
NSCPVKEANQTMLKDFLERLKMIMKEKYSKC
NT seq 456 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttcccgctctgttctttctgttagcatgcgccggcaac
tttgtccatggacacaactgcgatgttgccttagaggagatcatcaaaactttgaacatt
gtcacagagcaaaagactctgtgcaccgagttgaccgtaatggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcaactgcacagcatttccacagtcac
aagcagctgatccgatccctgaaacggctggacaggaacctctgcagcctggcgggcttg
aactcctgtcctgtgaaggaagccaaccagactatgttgaaagacttcttggaaaggcta
aagatgatcatgaaagagaaatattcaaagtgttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038789
Entry
101038789         CDS       T04350                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04664  Fc epsilon RI signaling pathway
sbq05200  Pathways in cancer
sbq05310  Asthma
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101038789 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101038789 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101038789 (IL13)
   04657 IL-17 signaling pathway
    101038789 (IL13)
   04664 Fc epsilon RI signaling pathway
    101038789 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038789 (IL13)
  09163 Immune disease
   05310 Asthma
    101038789 (IL13)
   05321 Inflammatory bowel disease
    101038789 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101038789 (IL13)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101038789 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 101038789
NCBI-ProteinID: XP_010337185
LinkDB
Position
Unknown
AA seq 133 aa
MALWLTMVIALTCLGGLASPGPVPPYTALKELIEELVNITQNQVSAPLCNGSMVWSINMT
AGVYCAALESLINVSRCSAIEKTQRMLSGFCPHKVSAGQFSSLLVQDTKIEVAQFVKDLL
RHLRKLFHQGKFN
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcgctttggttgaccatggtcattgctctcacttgcctcggcggccttgcctcccca
ggccccgtgcctccctatacagccctcaaggagctcattgaagagctggtcaacatcacc
cagaaccaggtgagtgcccccctctgcaatggcagcatggtgtggagcatcaacatgaca
gctggcgtgtactgtgcagccctggaatccctgattaacgtgtccaggtgcagtgccatc
gagaagacccagaggatgctgagcggattctgcccacacaaggtctcagccgggcagttt
tccagcttgcttgtccaagacaccaaaatcgaagtggcccagtttgtaaaggacctgctc
agacacttaaggaaactttttcaccagggaaagttcaactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039706
Entry
101039706         CDS       T04350                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K24382  cardiotrophin 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101039706 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101039706 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101039706 (CTF1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101039706 (CTF1)
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 101039706
NCBI-ProteinID: XP_010339155
LinkDB
Position
Unknown
AA seq 203 aa
MSCPLARLCLLTLLSPPLSSAAPISPAEPISQAYSLALYMQKNTSTLLQTYLRYQGSPFS
DPGFSAPELQLSSLPPATAFFKTWHALDDGERLRLAQGAFLALTQHLQLVGDDQSDLNPG
SPILLAQLRAARLRAQGLLGNMATIMTALGLPIPPEEDTLGLVAFGASAFERKCRGYVVT
REYGHWTDRAVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagctgtccactggcccgcctctgcctgctgaccctgctgtcaccacccctcagctca
gcagcccccatctccccggctgagcccattagtcaagcctacagcctggccctctacatg
cagaagaacacgtcaacgctgctgcagacttatctccggtaccagggcagcccttttagt
gaccctggcttctcagcccctgagctccagctcagcagcctgcctcctgccacggccttc
ttcaagacctggcatgccctggatgatggggaacggctgagacttgcccagggggccttc
ctggccttgacccagcacctccagctcgtgggggatgaccagagcgacctgaaccctggc
agtcccatcctgctggctcagctcagggctgcgagactcagggctcaaggcctgctaggc
aacatggccaccatcatgacggccctggggctgccaatccccccagaagaggatactctc
gggcttgttgcctttggggcctcggccttcgagaggaaatgtcgaggctacgtggtgacc
cgggaatatggccactggacagaccgtgctgtgagggacttggctctgctcaaggctaag
tacccagcatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039737
Entry
101039737         CDS       T04350                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05200  Pathways in cancer
sbq05310  Asthma
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101039737 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101039737 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101039737 (IL5)
   04660 T cell receptor signaling pathway
    101039737 (IL5)
   04658 Th1 and Th2 cell differentiation
    101039737 (IL5)
   04657 IL-17 signaling pathway
    101039737 (IL5)
   04664 Fc epsilon RI signaling pathway
    101039737 (IL5)
   04672 Intestinal immune network for IgA production
    101039737 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039737 (IL5)
  09163 Immune disease
   05310 Asthma
    101039737 (IL5)
   05320 Autoimmune thyroid disease
    101039737 (IL5)
   05321 Inflammatory bowel disease
    101039737 (IL5)
   05330 Allograft rejection
    101039737 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101039737 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101039737 (IL5)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101039737 (IL5)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101039737 (IL5)
SSDB
Motif
Pfam: IL5 NuiA
Other DBs
NCBI-GeneID: 101039737
NCBI-ProteinID: XP_003920659
UniProt: A0A2K6TJ20
LinkDB
Position
Unknown
AA seq 134 aa
MRMLLHLSLLALGAAHVCANPTARPTSALVKETLALLSTHRTLLMVNETLRIPVPAHKNH
QLCTEEIFQGIGTLENQTVQGSGVEKLFQNLSLIKEHIDRQKKKCGQERRRVKQFLDYLQ
EFLGVINTEWIIES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcccacgtgtgtgccaac
cccacagcacgtcccacaagtgcattggtgaaagagactttggcactgctttctactcat
cgaactctgctgatggtcaatgagaccctgaggattcctgttcctgcacataaaaatcac
cagctgtgcactgaagaaatctttcagggaataggcacattggagaaccaaactgtgcaa
gggagtggtgtggaaaagctattccaaaacttgtctttaataaaggaacacattgaccgc
caaaaaaaaaagtgtggacaagaaagacgaagagtaaagcaattcctagactacctgcaa
gagtttcttggtgtaataaacaccgagtggataatagaaagttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043435
Entry
101043435         CDS       T04350                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15
  KO
K05433  interleukin 15
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04668  TNF signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043435 (IL15)
   04668 TNF signaling pathway
    101043435 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101043435 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101043435 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043435 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101043435 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043435 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043435 (IL15)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101043435 (IL15)
SSDB
Motif
Pfam: IL15 DUF1439
Other DBs
NCBI-GeneID: 101043435
NCBI-ProteinID: XP_003928070
UniProt: A0A2K6T075
LinkDB
Position
Unknown
AA seq 162 aa
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSVGLPKTEANWVDVISDLRRI
QDLIQSIHIDATLYTESDVHPRCKVTAMKCFLLELQVISLESNNTNINDTIENLLILANR
SLSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFIYTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccattcagtgctacttgtgtttactt
ctaaacagtcattttctaactgaggctggcattcatgtcttcattttgggctgtttcagt
gtagggcttcctaaaacagaagccaactgggtggatgtaataagtgatttgagaagaatt
caagatcttattcaatctatacatattgatgctactttatatacggaaagtgatgttcat
cccaggtgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccaacaatacaaatattaatgataccatagaaaatcttctcatcctagcaaacaga
agtttatcttctaatgggaatattacagaatctggatgcaaagaatgtgaggaattggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtacaaatgttcatctac
acttcttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043583
Entry
101043583         CDS       T04350                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04650  Natural killer cell mediated cytotoxicity
sbq04657  IL-17 signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq05146  Amoebiasis
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05202  Transcriptional misregulation in cancer
sbq05221  Acute myeloid leukemia
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043583 (CSF2)
   04668 TNF signaling pathway
    101043583 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101043583 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101043583 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    101043583 (CSF2)
   04660 T cell receptor signaling pathway
    101043583 (CSF2)
   04657 IL-17 signaling pathway
    101043583 (CSF2)
   04664 Fc epsilon RI signaling pathway
    101043583 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101043583 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101043583 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101043583 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043583 (CSF2)
   05171 Coronavirus disease - COVID-19
    101043583 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043583 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101043583 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101043583 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043583 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101043583 (CSF2)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     101043583 (CSF2)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101043583 (CSF2)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101043583 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 101043583
NCBI-ProteinID: XP_003920668
UniProt: A0A2K6SAA5
LinkDB
Position
Unknown
AA seq 143 aa
MWLQNLLLLGTVAGSISAPTHLPSPDTQPLKHVNAIQEAQRLLNLSRDTAPETNETEVVS
EMFDRQEPTCLQTRVELYKESLRGSLTKLKGLLTMIASHYKQHCPPTLETSCATKIITYE
SFKENLKDFLLAIPVDCWDPVQE
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgctgctcttgggcactgtggccggcagcatctctgcacctacc
catttgcccagccccgacacacagcccttgaagcatgtgaatgccatccaggaggcccag
cgtctcctgaatctgagtagagacactgctcctgagacaaatgaaacagaagtggtctca
gaaatgtttgaccgccaggagccgacctgcctacagacccgcgtggagctgtacaaggaa
agcctgcggggcagcctcaccaagctcaagggcctcttgaccatgatagccagccactac
aagcagcactgccccccaaccctggaaacttcctgtgcaaccaagattatcacctatgaa
agtttcaaagagaacctgaaggactttttgcttgccatccctgttgactgctgggaccca
gtccaggagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043897
Entry
101043897         CDS       T04350                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04664  Fc epsilon RI signaling pathway
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05221  Acute myeloid leukemia
sbq05310  Asthma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043897 (IL3)
   04151 PI3K-Akt signaling pathway
    101043897 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101043897 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101043897 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101043897 (IL3)
   04664 Fc epsilon RI signaling pathway
    101043897 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043897 (IL3)
   05202 Transcriptional misregulation in cancer
    101043897 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101043897 (IL3)
  09163 Immune disease
   05310 Asthma
    101043897 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043897 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101043897 (IL3)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101043897 (IL3)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101043897 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 101043897
NCBI-ProteinID: XP_003920669
UniProt: A0A2K6SKY4
LinkDB
Position
Unknown
AA seq 135 aa
MSHLLILLLLLLVSPGLQAAPIQTTPLKTTQVNCSNLREEIVTLLNQPPLPSSNFSNLNW
EDQRILMKPNLRRPNLKAFQKAIKSLQNATAIESNLKDLSLCLPTATDAPTQHPIRIKDG
DWNDFRVKLKFYLKF
NT seq 408 nt   +upstreamnt  +downstreamnt
atgagccacctgctcatcctgctcctcctactcctggtcagccccggacttcaagctgcc
ccaatccagacaacgcccttgaagacaactcaggttaactgctctaacttgagggaggaa
attgtgacactcctaaaccagccacctttgccttcatcaaacttcagcaacttaaactgg
gaagaccaacgcattctgatgaaaccaaaccttcgaaggccaaacctgaaagcattccag
aaggccatcaagagtttacagaatgcaacagcaattgagagcaatcttaaggatctctca
ctatgcctgcccacggccacggatgcaccaacgcaacatccaatccgtatcaaggacggt
gactggaatgacttccgggtgaaactgaagttctatttgaagttctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043909
Entry
101043909         CDS       T04350                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043909 (OSM)
   04151 PI3K-Akt signaling pathway
    101043909 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101043909 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043909 (OSM)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101043909 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 101043909
NCBI-ProteinID: XP_003938505
UniProt: A0A2K6TF58
LinkDB
Position
Unknown
AA seq 249 aa
MGAPLTRRTLLSLVLTLLFPSMAAMGSCSKEYHVLLDQLQKQADLMQDTSSLLDPYIRIQ
GLDVPKLREHCREHPGAFPSEEGLQGLDRRGFLQTLNATLGHVMQRLAALEQQLPKAQDL
KRSRLNTEDLEKLQMARPNVLGLRNNVYCMAQLRDISDTAESTTAGRGTTQLPVPVPASD
SFQRKLEGCRFLHGYHRFMHSVGRVFRKWRESPSRSRRHSPRRAVRKEVRRTRPSRRGKR
LMPGGQLPR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgggggcaccgcttacacggaggacgctgctcagtctggtcctcacactcctgttccca
agcatggcagctatgggcagctgctcgaaagagtaccacgtgctcctcgaccaactccag
aagcaggcggatctcatgcaggacaccagcagcctcctggacccctacatacgtatccaa
ggcctggatgttcctaaactgagagagcactgcagggagcaccctggggccttccccagc
gaggagggcctgcagggcctggacaggcggggcttcctgcagaccctcaatgccacgctg
ggccacgtcatgcaaagactggctgccttagagcagcaactccccaaggcccaggacttg
aagaggtccaggctgaacaccgaggacttggagaagctgcagatggcgaggccgaatgtc
ctcgggctcaggaacaatgtctactgcatggcgcagctgcgggacatctcagacacggct
gagtccaccacagccggccgggggaccacccagctgcctgtccctgtcccggcctcggat
tcttttcagcgcaagctggagggctgcaggtttctgcacggctaccaccgcttcatgcac
tcagtggggcgggtcttcaggaagtggagggaaagcccgagccggagccggagacacagc
ccccggcgggccgtgcggaaggaggtgcgcaggaccagaccctccaggagaggcaagaga
ctcatgcccggggggcagctgccgcggtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044227
Entry
101044227         CDS       T04350                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101044227 (LIF)
   04668 TNF signaling pathway
    101044227 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101044227 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101044227 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101044227 (LIF)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101044227 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 101044227
NCBI-ProteinID: XP_003938506
UniProt: A0A2K6TIE6
LinkDB
Position
Unknown
AA seq 202 aa
MKVLAAGVVPLLLVLHWRHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKARLVELYRIVVYLGTALGNIT
RDQKILNPSALSLHSKLNATTDILRGLLSNVLCRLCSKYHVAHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQVIGMLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctagttctgcactggagacatggg
gcagggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccaaggggagccattccccaacaacctggacaag
ctgtgcggccccaatgtgacggacttcccgcccttccacgccaatggcacggagaaggcc
aggctggtggagctgtaccgcatagttgtgtatctcggcaccgccctgggcaacatcacc
cgggaccagaagatcctcaaccccagcgccctcagcctccatagcaagctcaacgccacc
accgacatcctgagaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtgacctatggccccgacacgtcgggtaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtataagcaggtcatcggcatgctggcccag
gccttctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044358
Entry
101044358         CDS       T04350                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04620  Toll-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04940  Type I diabetes mellitus
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101044358 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101044358 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101044358 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    101044358 (IL12A)
   04625 C-type lectin receptor signaling pathway
    101044358 (IL12A)
   04658 Th1 and Th2 cell differentiation
    101044358 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044358 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101044358 (IL12A)
   05330 Allograft rejection
    101044358 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101044358 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101044358 (IL12A)
   05134 Legionellosis
    101044358 (IL12A)
   05152 Tuberculosis
    101044358 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101044358 (IL12A)
   05164 Influenza A
    101044358 (IL12A)
   05162 Measles
    101044358 (IL12A)
   05168 Herpes simplex virus 1 infection
    101044358 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101044358 (IL12A)
   05144 Malaria
    101044358 (IL12A)
   05145 Toxoplasmosis
    101044358 (IL12A)
   05140 Leishmaniasis
    101044358 (IL12A)
   05142 Chagas disease
    101044358 (IL12A)
   05143 African trypanosomiasis
    101044358 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101044358 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101044358 (IL12A)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101044358 (IL12A)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101044358 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 101044358
NCBI-ProteinID: XP_010334025
LinkDB
Position
Unknown
AA seq 219 aa
MCPARSLLLVATLVLLDCLSLARNLPVATPDPRMFPCLHHSQTLLRAVSSMLQTARQTLK
FYPCTSKEIDHEDITKDKTSTVEACLPLELTKNESCLNSREISFITNGSCLASRKTSFMM
ALCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLAVIDKLMQALNFNSETVPQK
SSLEEPDFYRTKTKLCILLHAFRIRAVTIDRVMSYLNAS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtgcccagcgcgcagcctcctccttgtggccactctggtcctcctggactgcctcagc
ttggccagaaacctccccgtggccaccccagacccaagaatgttcccgtgccttcaccac
tcccaaaccctgctgagggccgtcagcagcatgctccagacggccagacaaactctaaaa
ttttacccttgcacttctaaagagattgatcatgaagatatcacaaaagataaaaccagc
acagtggaggcctgtttaccactggaattaaccaagaatgagagctgcctaaattccaga
gagatctcttttataactaatgggagttgcctggcctccagaaagacctcttttatgatg
gccctgtgccttagtagtatttatgaagacttgaagatgtaccaggtggagttcaaggcc
atgaatgcaaagctcctgatggatcctaagaggcagatctttctagatcaaaacatgctg
gcagttattgacaagctgatgcaggccctgaatttcaacagtgagactgtgccacaaaaa
tcctcccttgaagaaccggatttttatagaactaaaaccaagctctgcatacttcttcat
gctttcagaattcgggcagtgaccattgacagagtgatgagctatctgaatgcttcctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047729
Entry
101047729         CDS       T04350                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq05310  Asthma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101047729 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101047729 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101047729 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101047729 (IL9)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101047729 (IL9)
SSDB
Other DBs
NCBI-GeneID: 101047729
NCBI-ProteinID: XP_003920613
UniProt: A0A2K6UB61
LinkDB
Position
Unknown
AA seq 144 aa
MLLATVLTSALLLCSVASQGCPTSVGIRDINYLIDKMQEDPSSKCNCRANVTSCLCLPIP
SDNCTRPCFKEGLFQMTNTTVQTRYSLIFSRVKKSVEVLENKKCPYFSCEQPCNQTVAGN
VLTFLKSLLEVFQKEKMRGMGGKI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcttctggccacggtccttacttctgcgctgctcctctgctccgtggccagccagggg
tgtccaacgtcagtgggcatcagggatatcaactaccttatcgacaagatgcaggaagat
ccatcttcgaagtgcaactgcagagctaatgtgaccagttgtctctgcctgcccattcct
tctgacaactgcaccagaccatgcttcaaggagggactgtttcagatgaccaataccaca
gtgcaaacaagatactcactgattttcagtcgggtgaaaaaatcagttgaagtactagag
aacaagaagtgtccatatttctcctgtgaacagccatgcaaccaaaccgtggcaggcaac
gtgctgacatttctgaagagtctcctggaagttttccagaaagaaaagatgagaggaatg
ggaggcaaaatatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048813
Entry
101048813         CDS       T04350                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048813 (IL7)
   04151 PI3K-Akt signaling pathway
    101048813 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101048813 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101048813 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048813 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101048813 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101048813 (IL7)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101048813 (IL7)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101048813 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 101048813
NCBI-ProteinID: XP_003940240
UniProt: A0A2K6UVL8
LinkDB
Position
Unknown
AA seq 177 aa
MFHVSFRYIFGLPPLILALLPVASSDCDIEGKDGKQYESVLMISIDELLDSMKEIGSNCL
NNEFNFFKRHLCDDNKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSQGTTVLLNCTSK
VKERKPPALGEAQPTKSLEENKSLKEQKKLNESCFLKRLLQEIKTCWNKILSGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgctctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatgatcagcatcgatgaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatttatgtgatgataataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttc
gatctccacttattaaaagtttcacaaggcacaacagtactgttgaactgcaccagcaag
gttaaagaaagaaaaccacctgccctgggtgaagcccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgaatcatgtttcctaaagagactacta
caagagataaaaacttgttggaataagattttgagtggcactaaagaacattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048956
Entry
101048956         CDS       T04350                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11 isoform X1
  KO
K05417  interleukin 11
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048956 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101048956 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101048956 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101048956 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101048956 (IL11)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101048956 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 101048956
NCBI-ProteinID: XP_003944728
UniProt: A0A2K6TE89
LinkDB
Position
Unknown
AA seq 199 aa
MNWVCHLVLVVLSLWPDTAVAPGPPPGPPRASPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSHLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgggtttgccacctggtcctggtcgtgctcagcctgtggccagatacagctgtt
gcccctgggccaccacctggcccccctcgagcttccccagaccctcgggccgaactggac
agcaccgtgctcctgacccgctccctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcgctgggagctctgcagctcccgggcgtgctgacaaggctacgggcagac
ctgctgtcctacctgcggcacgtgcagtggctgcgccgggcaggcggctcctccctgaag
accctggagcccgagctgggcaccctgcaggcccggctggaccggctgctgcgccggctg
cagctcctgatgtcccacctggccctgccgcagccgcccccagacccgccggccccccca
ctggcacccccttcctcagcctgggggggcatcagagccgcccacgccatcttggggggg
ctgcacctgacacttgactgggctgtgcgggggctgctgctgctgaagacccggctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049311
Entry
101049311         CDS       T04350                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04620  Toll-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04940  Type I diabetes mellitus
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05321  Inflammatory bowel disease
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101049311 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101049311 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101049311 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    101049311 (IL12B)
   04625 C-type lectin receptor signaling pathway
    101049311 (IL12B)
   04658 Th1 and Th2 cell differentiation
    101049311 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049311 (IL12B)
   05205 Proteoglycans in cancer
    101049311 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101049311 (IL12B)
   05330 Allograft rejection
    101049311 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101049311 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101049311 (IL12B)
   05134 Legionellosis
    101049311 (IL12B)
   05152 Tuberculosis
    101049311 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101049311 (IL12B)
   05164 Influenza A
    101049311 (IL12B)
   05162 Measles
    101049311 (IL12B)
   05168 Herpes simplex virus 1 infection
    101049311 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101049311 (IL12B)
   05145 Toxoplasmosis
    101049311 (IL12B)
   05140 Leishmaniasis
    101049311 (IL12B)
   05142 Chagas disease
    101049311 (IL12B)
   05143 African trypanosomiasis
    101049311 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101049311 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101049311 (IL12B)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101049311 (IL12B)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101049311 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_2 Ig_3 fn3 Ig_4
Other DBs
NCBI-GeneID: 101049311
NCBI-ProteinID: XP_003934806
UniProt: A0A2K6TD44
LinkDB
Position
Unknown
AA seq 328 aa
MCHQRLVISWFSLVLLASPLVAIWELKKDVYVIELDWYLDAPGEMVVLTCDTPEEDGITW
TLDESSEVLGSGKNLIIQVKEFGDAGQYTCHKGGKALNHLLLLLHKKEDGVWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGFSDPRGVMCGAPMLSAERV
RGDSKEYEYSVECQEDSACPAAEERLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVCVDKTSATVIC
RKNASVSVQAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgccaccagcggttggtcatctcttggttttccctggttttgctagcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcatagaattggattggtacctggat
gcccctggagaaatggtggttctcacctgtgacacccctgaagaagatggtatcacctgg
accttggacgagagcagtgaggtcttaggctctggcaaaaacctgatcatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcaaggctctgaaccatttg
cttctgctgcttcacaaaaaggaagatggagtttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggcttttctgacccccgaggggtgatgtgcggagcacctatgctctctgcagagagggtc
agaggggacagcaaggagtatgagtactcggtggagtgtcaggaggacagtgcctgccca
gccgctgaggagaggctgccaattgaggtcatggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acgtggagtactccacattcttacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtctgcgtggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcgttagtgtgcaggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051084
Entry
101051084         CDS       T04350                                 

Gene name
IL24
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-24
  KO
K22668  interleukin 24
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101051084 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101051084 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101051084 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101051084 (IL24)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101051084 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 101051084
NCBI-ProteinID: XP_003930481
LinkDB
Position
Unknown
AA seq 206 aa
MNFQXRLQSLWSLAGRPSCPPLLAMASRIQMAALICLSLLLLWSQVPGAQGQKFQFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSVRLLRQEVLQNVSAAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFILIVSQLQPSKENEMFAIRDSAHRRFLLFRRAFKEL
DMEAALTKALGEVDVLLTWMQKFYKF
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaattttcagtagaggctgcaaagcctgtggagcttagctggcagaccctcctgtcca
cctttgctggcgatggcctctcgaatacagatggctgcgctcatttgcttgagtctccta
cttctctggagccaggtgccaggggcccagggccaaaaattccaatttgggccctgccaa
gtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaggacactatg
caggctcaagataacatcacgagtgtccggctgctgcggcaggaagttctgcagaacgtc
tcggctgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaactgtt
ttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctactctg
gccaacaacttcattctcatcgtgtcacaactgcaacccagcaaggaaaatgagatgttt
gccatcagagacagtgcacacaggcggtttctgctattccggagagcatttaaagagttg
gacatggaagcagccctgaccaaagcccttggggaagtggatgttcttctgacctggatg
cagaaattctataagttctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051559
Entry
101051559         CDS       T04350                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04622  RIG-I-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101051559 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101051559 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101051559 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101051559 (IFNK)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101051559 (IFNK)
SSDB
Motif
Pfam: Interferon Mit_KHE1
Other DBs
NCBI-GeneID: 101051559
NCBI-ProteinID: XP_003939795
LinkDB
Position
Unknown
AA seq 259 aa
MSTKPDMIQKCLWLELFVGLFIAGTLSLDCNLLNVHLRRVTWQNLRLLSMSNSFPIECLQ
ENIAFELPQEFLQYTQPMKRDMWKAFHEMSLQAFNIFSQHTFKSTWKEKHLKQIQTGLDQ
QAEYLNQCLEEEENENEVMKEMKVDEMKTSEARVPHPRNLELRRYFKRIDNFLKEKKYSD
CAWEIVRVKIRRCLYYFYKFTALLGTEILFPPKSLSPSLPPSSKDYCAILQAWPQLDWWP
GNIRDIYLSKETKSLVRKF
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcaccaaacctgatatgattcaaaagtgtttgtggcttgagctctttgtgggtcta
ttcattgctggcaccctgtctctggactgtaacttactgaatgttcacctgagaagagtc
acctggcaaaatctgagacttcttagtatgagcaattcatttcctatagaatgtctacaa
gaaaacatagcttttgagttgccccaagagtttctacaatacacccagcctatgaaaagg
gacatgtggaaggccttccacgaaatgtccctacaggcctttaacatcttcagccaacac
accttcaaatccacttggaaagagaaacacctcaaacaaatccaaacaggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagaggagaatgaaaatgaagtcatgaaa
gaaatgaaagtggatgagatgaaaacctcagaagccagggtcccccacccgaggaacctg
gaactgaggagatatttcaaaaggatagacaattttctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtgaaaatcagaagatgtttgtactacttttacaaattc
acagctcttttgggaactgaaatcctgttccctccgaaatccctttctccttctcttcct
ccatcttctaaggattactgtgctattctgcaagcctggcctcagttggattggtggcct
gggaacataagggacatttacctctctaaggagaccaagagtcttgttagaaagttttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051615
Entry
101051615         CDS       T04350                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20 isoform X1
  KO
K22667  interleukin 20
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101051615 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101051615 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101051615 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101051615 (IL20)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101051615 (IL20)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 101051615
NCBI-ProteinID: XP_003930482
UniProt: A0A2K6SM35
LinkDB
Position
Unknown
AA seq 176 aa
MKASGLAFSLLSAAFYLLWTPSTGLKTLHLGKCVIATNLQEIRNGFSEIRGSVQAKDGNI
DVRILRRTESLQDTKPADRCCLLRHLLRLYLDRVFKDYQTPDHHTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEGATKKYSQILSHFEELEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctggtcttgccttcagccttctttctgctgcattttatctcctctggact
ccttccactggactgaagacactccatttgggaaagtgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacatt
gatgtcagaatcttaaggaggactgagtccttacaagacacaaagcctgcagatcggtgc
tgcctcctgcgccatttgctaagactctacctggacagagtatttaaggactaccagact
cctgaccatcatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggagggagcaacgaag
aaatacagccagattctgagtcactttgaagagcttgagcctcaggcagcagttgtgaag
gctttgggagaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051941
Entry
101051941         CDS       T04350                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101051941 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101051941 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101051941 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101051941 (IL19)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101051941 (IL19)
SSDB
Motif
Pfam: IL10 MIF4G
Other DBs
NCBI-GeneID: 101051941
NCBI-ProteinID: XP_010339316
UniProt: A0A2K6S329
LinkDB
Position
Unknown
AA seq 177 aa
MKLQCVSLWLLGTMLILCFVDSRSLRKCLISTDMHHVEESFQEIKRAIQAKDIFPNVTIL
STLETLQSIKPLDVCCVTKNLLAFYVDRVFKDHQEPHPQILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNVTRVIHDNYDQLEARSAAIKSLGELDVFLAWIDKNHEVTSSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtgtgtttccctttggctcctgggtacaatgctgatcttgtgcttcgtg
gacagccgtagtctcaggaaatgtctgatttccacagacatgcaccatgtagaagagagt
ttccaagaaatcaaaagagccatccaagctaaggacatcttcccaaatgtcactatcctg
tccacattggagactctgcagagcattaagcccttagatgtgtgctgcgtgaccaagaat
ctcctggcattctatgtggacagggtgttcaaggatcatcaagagccacacccccaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaaccttgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccacaaatgtcaccagagtcatc
catgacaactatgatcagctggaggcccgctctgctgccattaagtctctgggagagctc
gatgtctttctagcctggattgataagaatcatgaagtaacatcctcagcttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052580
Entry
101052580         CDS       T04350                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04068  FoxO signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05150  Staphylococcus aureus infection
sbq05152  Tuberculosis
sbq05310  Asthma
sbq05320  Autoimmune thyroid disease
sbq05321  Inflammatory bowel disease
sbq05322  Systemic lupus erythematosus
sbq05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101052580 (IL10)
   04068 FoxO signaling pathway
    101052580 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101052580 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101052580 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101052580 (IL10)
   04660 T cell receptor signaling pathway
    101052580 (IL10)
   04672 Intestinal immune network for IgA production
    101052580 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101052580 (IL10)
   05322 Systemic lupus erythematosus
    101052580 (IL10)
   05320 Autoimmune thyroid disease
    101052580 (IL10)
   05321 Inflammatory bowel disease
    101052580 (IL10)
   05330 Allograft rejection
    101052580 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101052580 (IL10)
   05133 Pertussis
    101052580 (IL10)
   05150 Staphylococcus aureus infection
    101052580 (IL10)
   05152 Tuberculosis
    101052580 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101052580 (IL10)
   05144 Malaria
    101052580 (IL10)
   05145 Toxoplasmosis
    101052580 (IL10)
   05140 Leishmaniasis
    101052580 (IL10)
   05142 Chagas disease
    101052580 (IL10)
   05143 African trypanosomiasis
    101052580 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101052580 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101052580 (IL10)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101052580 (IL10)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101052580 (IL10)
SSDB
Motif
Pfam: IL10 IL22 2_5_RNA_ligase2
Other DBs
NCBI-GeneID: 101052580
NCBI-ProteinID: XP_003930485
UniProt: A0A2K6USW7
LinkDB
Position
Unknown
AA seq 178 aa
MHSSALLCCLVFLTGVRASPGQGTQSENSCTHFPGSLPHMLRELRVAFGRVKTFFQKKDQ
LDSTLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFR
LRLRRCHRFLPCENKSKAVAQVKNAVSKLQEKGVYKAMSEFDIFIDYIEAYMTMKTQN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagctctgctctgttgcctggtcttcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcagcctgcctcacatg
cttcgagagctccgagttgcctttggcagagtgaagactttctttcaaaagaaggatcag
ctagacagcacgctgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
catgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagactttcagg
ctgaggctgcgacgctgtcatcgattccttccctgtgaaaacaagagtaaggcagtggcg
caggtgaagaatgccgttagtaagctccaagagaaaggcgtctacaaagccatgagtgag
tttgacatcttcatcgactacatagaagcctacatgacaatgaagacgcagaactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053421
Entry
101053421         CDS       T04350                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04657  IL-17 signaling pathway
sbq04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053421 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101053421 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101053421 (IL17D)
   04659 Th17 cell differentiation
    101053421 (IL17D)
   04657 IL-17 signaling pathway
    101053421 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101053421 (IL17D)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101053421 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 101053421
NCBI-ProteinID: XP_010330458
LinkDB
Position
Unknown
AA seq 205 aa
MERALILHSCEIPAGLWLLARSALSAPSPSFSRPAPSLSLKPTIAVPSPGPKWMHPLGAA
QPCSRTGPSRRPPRCLSPGISAPGAGLSPGATSAVLSPCRISYDPARYPRYLPEAYCLCR
GCLTGLFGEEDVRFRSAPVYMPTVVLRRTSACAGGRSVYTEAYVTIPVGCTCVPEPEKDA
DSINSSIDKQGAKLLLGPNDAPAGP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagagagctctcatccttcattcctgtgagatccctgcaggcctctggctcctggcc
cggtcagcactgtccgcccccagcccctctttctctagacctgccccaagcctgtccttg
aaacccaccatagctgtccccagcccaggccccaagtggatgcatccgttgggggctgca
cagccttgcagcaggacaggaccgtcccgccgccctccccggtgcctctcaccagggatc
tcagcgcccggcgccgggctgtccccaggcgcgacctcagcagtgctctctccctgcaga
atctcctacgacccggcgaggtaccccaggtacctgcccgaagcttactgcctgtgccgg
ggctgcctgaccgggctgttcggcgaggaggacgtgcgcttccgcagcgccccggtctac
atgcccaccgtggtcctgcgccgcacgtccgcctgcgcgggcggccggtcggtctacacc
gaggcctacgtcaccatccccgtgggctgcacctgcgtccccgagccggagaaggacgca
gacagcatcaactccagcatcgacaaacagggcgccaagctcctgctgggtcccaatgac
gcgcccgctggcccgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053895
Entry
101053895         CDS       T04350                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053895 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101053895 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101053895 (TSLP)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101053895 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 101053895
NCBI-ProteinID: XP_003920983
LinkDB
Position
Unknown
AA seq 157 aa
MKNLGQSKKEEVSFRKIFILQLVGLVLTYDFTNCDFMEIKKEYWRTIGEDLRTYMSGTKS
TEFNTTIFCNNRSHCLTEIQRLTFNPTLGCASLAKELFAVRTNATLALWCPGYSETQIND
TQAMKKRKKRKVTTNKCLEQVSQLQGLWRRFIRTLRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaagaatttagggcaaagcaaaaaggaggaagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgctaacttacgacttcactaactgtgactttatggagattaaa
aaagagtattggcgtactattggtgaagacttgcgtacatatatgagtgggaccaaaagt
accgagttcaacaccaccatcttttgtaacaatcggtcacactgccttactgaaatccag
cgcctgaccttcaatcccaccctcggctgcgcgtcgctggccaaggaactgttcgctgtg
agaactaacgctaccctcgctctctggtgcccaggctattcggaaactcagataaatgat
actcaggcaatgaagaagaggaaaaaaagaaaagtcacaaccaataagtgtctggaacaa
gtctcacagttacaaggattgtggcgtcgcttcattcgaactttaaggaaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104649849
Entry
104649849         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104649849
   04151 PI3K-Akt signaling pathway
    104649849
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104649849
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104649849
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104649849
   04621 NOD-like receptor signaling pathway
    104649849
   04622 RIG-I-like receptor signaling pathway
    104649849
   04623 Cytosolic DNA-sensing pathway
    104649849
   04650 Natural killer cell mediated cytotoxicity
    104649849
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104649849
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104649849
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104649849
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104649849
   05161 Hepatitis B
    104649849
   05160 Hepatitis C
    104649849
   05171 Coronavirus disease - COVID-19
    104649849
   05164 Influenza A
    104649849
   05162 Measles
    104649849
   05168 Herpes simplex virus 1 infection
    104649849
   05163 Human cytomegalovirus infection
    104649849
   05167 Kaposi sarcoma-associated herpesvirus infection
    104649849
   05169 Epstein-Barr virus infection
    104649849
   05165 Human papillomavirus infection
    104649849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    104649849
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   104649849
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104649849
NCBI-ProteinID: XP_010337022
LinkDB
Position
Unknown
AA seq 111 aa
MALPFTLLMALVLCSCFLGCDLPQTHILDNRRTTVLLAQMRRISPFSCLKDRHDFEFPQE
EFDDKPFQKAQANSVHEMIQQIFNLFSTKDSSAPWDETLLLGMRLLNSSYE
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccttgccctttactttactgatggccctagtgctatgcagctgttttctgggctgt
gatctgcctcagacccacatcctggataacaggaggaccacagtcctcctggctcaaatg
aggagaatctctcctttctcttgtctgaaggacagacatgactttgaatttccccaggag
gagtttgatgacaaaccgttccaaaaggctcaagccaactctgtccatgagatgatccag
cagatcttcaacctctttagcacaaaggactcatctgctccttgggatgagaccctgctg
cttgggatgagactactgaactctagttatgaatga

DBGET integrated database retrieval system