KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028636
Entry
101028636         CDS       T04350                                 

Gene name
ACSL1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1 isoform X2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04216  Ferroptosis
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101028636 (ACSL1)
   00071 Fatty acid degradation
    101028636 (ACSL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101028636 (ACSL1)
  09143 Cell growth and death
   04216 Ferroptosis
    101028636 (ACSL1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101028636 (ACSL1)
   03320 PPAR signaling pathway
    101028636 (ACSL1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101028636 (ACSL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101028636 (ACSL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101028636 (ACSL1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101028636 (ACSL1)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101028636 (ACSL1)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101028636 (ACSL1)
  Exosomal proteins of breast cancer cells
   101028636 (ACSL1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101028636
NCBI-ProteinID: XP_003933892
UniProt: A0A2K6TZS5
LinkDB
Position
Unknown
AA seq 698 aa
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQ
SVEVAGSGGARRSTLLDSDEPLVCFYEDVTTLYEGFQRGIHVSNNGPCLGSRKPDQPYEW
LSYKQVAELSECIGSALLQKGFKATPDQCVGIFAQNRPEWVIIEQGCFAYSMVIVPLYDT
LGSEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVLMDAYGSELVERGKK
CGVEVISMKAMEDLGRTNRQKPKPPAPEDLAVICFTSGTTGNPKGALITHRNVVSDCSAF
VKMTEKVLPLNASDTHISFLPLAHMYEQLMLCVMLCHGAKIGFFQGDIRLLMDDLKVLQP
TVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKI
QSSLGGRVRLMITGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTVPGDWTAGHV
GAPMPCNWIKLVDVEEMNYMAAKGEGEVCVKGPNVFQGYLKEPAKTAEALDKDGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEPVAQVFVHGESLQAFLIAI
VVPDSEILCSWARKRGFDGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGIALHP
ELFSVYNGLLTPTMKAKRPELRNYFRSQIDELYSTVKV
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgcaagcccacgaattgttccggtattttcgaatgccagagctggttgacttccgacaa
tacgtgcgcactcttccgaccaacacgcttatgggcttcggagcttttgcagcactcacc
actttctggtacgccacgagacccaaagccctgaagccaccatgtgacctctccatgcag
tcagtggaagtggcgggtagtggtggtgctcgaagatccacactacttgacagcgatgag
cccttggtgtgtttctatgaggatgtcacaacattatacgaaggtttccagaggggaata
catgtgtcaaataacggcccctgtttaggctctcggaaaccagaccaaccctatgaatgg
ctttcatacaagcaggttgcagaattgtcggagtgcataggctcagcactgctccagaag
ggcttcaaggccaccccagatcagtgtgttggcatctttgctcaaaacagaccagagtgg
gtgattattgaacaaggatgctttgcttattcgatggtgattgttccactttatgatacc
cttggatctgaagccatcacatacatagtcaacaaagctgaactctctctggtttttgtt
gacaagccagagaaggccaaactcttactagagggtgtagaaaataagttaataccaggc
cttaaaatcatagttctcatggatgcttatggcagtgaactggtggaacgaggcaagaag
tgtggggtggaagtcatcagcatgaaggcgatggaggacctgggaagaaccaacagacag
aagcccaagcctccagcacctgaagatcttgcagtaatttgtttcacaagtgggactaca
ggcaatcccaaaggagcactgatcactcatcgaaacgtagtgagcgattgttcagctttt
gtgaaaatgacagagaaagtacttcccttgaatgccagtgacacacatatttcgttttta
ccacttgcacacatgtatgaacagctcatgctgtgtgtgatgctgtgtcacggagctaaa
attggatttttccaaggagatatcaggctgcttatggatgacctcaaggtgcttcaaccc
actgtattccctgtggttccgagactgctgaaccggatgtttgaccgaattttcggacaa
gcaaacaccacactgaagcgatggctcttggactttgcctccaagaggaaagaagcagaa
ctccgcagcggcatcgtcagaaacaacagcctgtgggacaagctgatcttccacaaaata
cagtcgagcctgggcggaagagtccggctgatgatcacaggagccgcaccggtgtctgct
actgtgctgacgttcctcagagcagccctgggctgtcagttttatgaaggctacggacag
accgagtgtactgccgggtgctgtctgaccgtgcctggagactggaccgcaggtcatgtt
ggggccccgatgccttgcaattggataaaactggttgatgtggaagaaatgaattacatg
gctgccaagggcgagggtgaggtgtgtgtgaaagggccaaatgtatttcagggctacttg
aaggaaccagcaaaaacagcagaagctttggacaaagacggctggttacacacaggggat
attggaaaatggttaccaaatggcaccttgaagatcattgacaggaaaaagcacatattt
aagctggcacaaggagagtacatagcacctgaaaagattgaaaatatctacctgcgaagt
gagcctgttgctcaggtgtttgtccatggagaaagcttgcaggcatttctcatcgcaatt
gtggtaccagattccgagatattatgttcctgggcccgaaagagaggatttgatgggtcc
tttgaggagttgtgcagaaataaggatgtcaaaaaagctatccttgaagacatggtgaga
cttgggaaggattctggtctaaaaccatttgaacaggtcaaaggcatcgcactgcaccct
gaattgttttctgtctacaacggccttctgactccaacaatgaaggcgaaaaggccagag
ctccggaactatttcaggtcgcagatagatgaactttattccactgtcaaggtttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031622
Entry
101031622         CDS       T04350                                 

Gene name
ACSL5
Definition
(RefSeq) LOW QUALITY PROTEIN: long-chain-fatty-acid--CoA ligase 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04216  Ferroptosis
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101031622 (ACSL5)
   00071 Fatty acid degradation
    101031622 (ACSL5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101031622 (ACSL5)
  09143 Cell growth and death
   04216 Ferroptosis
    101031622 (ACSL5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101031622 (ACSL5)
   03320 PPAR signaling pathway
    101031622 (ACSL5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101031622 (ACSL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101031622 (ACSL5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101031622 (ACSL5)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101031622 (ACSL5)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101031622 (ACSL5)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101031622 (ACSL5)
  Exosomal proteins of breast cancer cells
   101031622 (ACSL5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Tachykinin
Other DBs
NCBI-GeneID: 101031622
NCBI-ProteinID: XP_010331249
LinkDB
Position
Unknown
AA seq 739 aa
MDAPKPPCLWRNWEXGKKGGESCARKNPEPGSPRSLEALRDAAPSQGLNFLLLFTKMLFI
FNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNKQSVGIEGGARKGASQKNN
DLISYYFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSYLLH
KGYKPSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGAEAIIHIVNKADISTVI
CDTPPKASILIENVEKGLTPGLKVVILMDPFDDDLKQRGEKSGIEILSLFDAENLGKENF
RKPVPPSPEDLSIICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHTFEVTSDDVTISY
LPLAHMFERVVQTVVYSCGARVGFFQGDIRLLSDDMKTLKPTVFPTVPRLLNRVYDKVQN
EAKTPLKKFLLNLAVASKFKEVQKGIIRHDSLWDKFIFKKIQDSLGGRVRFMVTGAAPIS
APVMTFFRAAMGCQVYEAYGQTECTAGCTITLPGDWTSGHVGAPLACNYVKLEDVADMNY
FSVNNEGEICIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNI
FKLAQGEYIAPEKIENIYIRSRPVAQVFVHGESLRSSLVGVVVPDTDTLPSFAAKLGVKG
SFEELCQNQVVRKAVLEDMQKIGKESGLKSFEQVKAIFLHPEPFSIENGLLTPTLKAKRG
ELSKYFRTQIDSLYEHIQD
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggacgctccgaagccaccctgtctctggaggaactgggagtgagggaagaagggcggg
gagtcgtgtgccaggaagaacccggagccaggaagcccccgttctctagaagcactgaga
gatgcggccccctcccagggtctgaatttcctgctgctattcacaaagatgctttttatc
tttaattttttgttttccccactcccgaccccggcgttgatctgcatcctgacatttgga
gctgccatcttcctgtggctgatcaccagacctcaacctgtcttacctcttctcgatctg
aacaaacagtctgtgggaattgagggaggagcgcggaagggtgcttcccagaagaacaat
gacctaataagttactacttctcagatgccaagactatgtatgaggttttccaaagagga
ctcgctgtgtctgacaatgggccctgcttgggatacagaaaaccaaaccagccctacaga
tggctatcctacaaacaggtgtctgatagagcggagtacctgggttcctatctcttgcat
aaaggatataaaccatcaccagaccaatttgttggcatctttgctcagaataggccagag
tggatcatctctgaattggcttgttacacatactctatggtagccgtacctctgtatgac
accttgggagcagaagccatcatacatattgtcaacaaggctgatatctccacggtgatc
tgtgacacacctccaaaggcatccatcctgatagagaatgtagagaaaggcttaacccca
ggcctgaaggtggtcatccttatggacccctttgatgatgacctgaagcaaagaggggag
aagagtggaattgagatcttatccctgtttgatgctgagaacctaggcaaagagaacttc
aggaaacctgtgcctcctagcccggaagacctgagcatcatctgcttcaccagtgggacc
acaggtgaccccaaaggagctatgataacccatcaaaatatcgtttcaaatgctgctgcc
tttctcaaatgtgtggagcatacttttgaggtcacttccgatgatgtgaccatatcctac
ctccctctggctcatatgtttgagagagttgtacagactgttgtgtactcctgtggagcc
agagttggattcttccaaggggatattcggttgctgtctgatgacatgaagactttgaag
cccacagtgtttcccacagtgcctcgactccttaacagggtctacgataaggtacaaaat
gaagccaagacacccttgaagaagttcttgctgaatttggctgttgccagtaaattcaag
gaagttcaaaagggtatcatcaggcatgacagtttgtgggacaagttcatctttaaaaag
atccaggacagcctgggcgggagggttcgcttcatggtcaccggagctgcccccatctct
gctccagtcatgacgttcttccgggcagcaatgggatgtcaggtgtatgaagcatatggt
caaacagaatgcacagctggctgtacaattacattacctggggactggacatcaggtcac
gttggagcacccctcgcctgcaattatgtgaagctggaagatgtggctgatatgaactac
ttttcagtgaataatgaaggagagatctgcatcaagggtaccaacgtgttcaaaggatac
ctgaaggaccccgagaagacacaggaagccctggacagtgatggctggcttcacacagga
gacattggtcgctggctcccgaatggaactctgaagatcattgaccgtaaaaagaacatt
ttcaagttggcccaaggagaatacattgcgccagagaagatagaaaatatctacatcagg
agtagaccagtggcacaagtttttgtacatggggagagcttacggtcatccttagtagga
gtggtggttcctgacacagatacacttccctcatttgcagccaagcttggggtgaagggc
tcctttgaggaactgtgccaaaaccaagttgtaagaaaagccgttttagaagacatgcag
aagattgggaaagaaagcggccttaaatcctttgaacaggtcaaggccatttttcttcat
ccagagccattttccattgaaaatgggctgttgacaccaacattgaaagcaaagcgggga
gagctttccaaatacttccggacccaaattgacagcctgtatgagcacatccaggattag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033719
Entry
101033719         CDS       T04350                                 

Gene name
ACSL4
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4 isoform X2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04216  Ferroptosis
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101033719 (ACSL4)
   00071 Fatty acid degradation
    101033719 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101033719 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    101033719 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101033719 (ACSL4)
   03320 PPAR signaling pathway
    101033719 (ACSL4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101033719 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101033719 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101033719 (ACSL4)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101033719 (ACSL4)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101033719 (ACSL4)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101033719 (ACSL4)
  Exosomal proteins of breast cancer cells
   101033719 (ACSL4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101033719
NCBI-ProteinID: XP_003935906
UniProt: A0A2K6TFR4
LinkDB
Position
Unknown
AA seq 670 aa
MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREI
LSEENEMQPNGKVFKKLILGNYKWMSYLEVNLRVNNFGSGLTALGLKPKNTIAIFCETRA
EWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLEGKLKTALLDINC
VKHIIYVDNKTINKAEYPEGFEIHSMQSVEELGSNPENLSIPPSRPTPSDMAIVMYTSGS
TGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIG
YSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFK
IGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCP
VGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVI
GGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGE
YVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICN
NPAMEAEILKEIREAANAMNLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYL
KDIERMYGGK
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcaaagagaataaaagctaagcccacttcagacaaacccggaagtccatatcgctct
gtcacacacttcgactcgctagctgtaatagacatccctggagcagatactctggataaa
ttgtttgaccatgctgtatccaagtttgggaagaaggacagccttgggaccagggaaatc
ttaagcgaagaaaatgaaatgcagccaaatggaaaagtttttaagaagttaattcttggg
aattataaatggatgagctatcttgaagtgaacctcagagtgaacaactttggtagtgga
ctcactgcactgggactaaaaccaaagaacacaattgccatcttttgtgagaccagggct
gaatggatgattgcagcacagacctgctttaagtacaactttcctcttgtgactttatat
gccacacttggcaaagaagcagtagttcatgggctaaatgaatctgaggcttcctatctg
attactagtgttgaacttctggaaggtaaacttaagactgcattgttagatatcaattgt
gttaagcatatcatttatgtggacaataagactatcaataaagcagagtaccctgaagga
tttgagattcacagcatgcaatcagtagaagagttgggatccaacccagaaaacttgagc
attcctccaagtagaccaacaccttcagacatggccattgttatgtatactagtggttct
acgggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgacgggc
caatgtgaaagaatacctggactgggaccaaaggacacatatattggctacttgcctttg
gctcatgtgctagaattgacagcagagatatcttgctttacctatggctgcaggattgga
tattcttctccgcttacactctctgaccagtccagcaaaattaaaaaaggaagcaaagga
gactgtactgtactgaagcccacacttatggctgctgttccggaaatcatggatagaatt
tataagaatgttatgagcaaagtccaagagatgaattatattcagaaaactctgttcaag
atagggtatgattacaaattggaacagatcaaaaaaggatatgatgcacctctttgcaat
ctgttactgtttaaaaaggtgaaggctctgctgggaggtaatgtccgcatgatgctctct
ggaggggccccgctatctcctcagacacaccgattcatgaatgtctgcttctgctgccca
gttggccagggttatggactgacagaatcatgtggtgctgggacagttactgaagtaact
gactatactactggcagagttggagccccccttatttgctgtgagattaagctaaaagac
tggcaggaaggcggttatacaattaatgacaagccaaaccccagaggtgaaatcgtaatt
ggtggacagaacatctccatgggatattttaaaaacgaagagaaaacagcagaggattat
tctgtggatgaaaatggacaaagatggttttgcactggtgatattggagaattccatcct
gatggatgtttacagattatagatcgtaagaaagatttagtgaagttacaagcaggagaa
tatgtatctcttgggaaagtggaagctgcactgaagaattgtccacttattgacaacatc
tgtgctttcgccaaaagtgaccagtcctatgtgatcagttttgtggttcctaatcagaaa
aggttgacacttttggcacaacagaagggggtagaaggaacttgggttgatatctgcaat
aatcctgctatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatgaat
ttggagcgatttgaaattccaatcaaggttcgattaagtccagagccatggactcctgaa
actggtttggtaacagatgctttcaaactgaaaaggaaggagctgaagaaccattacctc
aaagacattgaacgaatgtatgggggcaaataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041309
Entry
101041309         CDS       T04350                                 

Gene name
ACSL3
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04216  Ferroptosis
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101041309 (ACSL3)
   00071 Fatty acid degradation
    101041309 (ACSL3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101041309 (ACSL3)
  09143 Cell growth and death
   04216 Ferroptosis
    101041309 (ACSL3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101041309 (ACSL3)
   03320 PPAR signaling pathway
    101041309 (ACSL3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101041309 (ACSL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101041309 (ACSL3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101041309 (ACSL3)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101041309 (ACSL3)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101041309 (ACSL3)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101041309 (ACSL3)
  Exosomal proteins of breast cancer cells
   101041309 (ACSL3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101041309
NCBI-ProteinID: XP_010334543
UniProt: A0A2K6SKL0
LinkDB
Position
Unknown
AA seq 720 aa
MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNQIKAKPV
NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDELQPN
GKIFKKVILGHYNWLSYEDVFVRAFNFGCGLQKLGQKPKTNIAIFCETRAEWMIAAQACF
MYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPCLRHIITVDGK
PPTWSEFPKGVIVHTMAAVQALGAKASTENQPHSKPLPSDIAVIMYTSGSTGLPKGVMIS
HSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ
SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVNEMSSFQRNLFILAYNYKMEQI
SKGRNTPLCNSFVFQKVRSLLGGNIRLLLCGGAPLSAATQRFMNICFCCPVGQGYGLTES
AGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYY
KNEAKTKADFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAA
LKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLK
VLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgaataaccacgtgtcttcaaaaccatctaccatgaagctgaaacataccatcaaccct
attcttttatattttatacattttctaatatcactttatactattttaacatacattcca
ttttattttttctctgagtcaagacaagaaaaatcaaaccaaattaaagcaaagccagta
aattcaaaacctgattctgcatacagatctgttaatagtttggatggtttggcttcagta
ttataccctggatgtgatactctagataaagtttttacatatgcaaaaaacaaatttaag
aacaaaagactcttgggaactcgtgaagttttaaatgaggaagatgaattacaaccaaat
ggaaaaatttttaaaaaggttattcttggacattataattggctatcctatgaagatgtc
ttcgttagagcctttaattttggatgtggcttacagaaattgggtcaaaaaccaaagacc
aacatcgccatcttctgtgagactagggctgagtggatgatcgctgcacaggcgtgtttt
atgtataattttcagcttgttacgttatatgctactctaggaggtccagccattgttcat
gggttaaatgaaacagaggtgaccaacatcattactagtaaagaactcttacaaacaaag
ttgaaggacatagtttctttggtcccatgcctgcggcacatcatcactgtcgatggcaag
ccaccaacctggtccgagttccccaagggtgtcattgtgcataccatggctgcagtgcag
gccctgggagccaaggccagcacggaaaaccaacctcatagcaaaccgttgccttcagat
atcgcagtaatcatgtacacaagtggatccacaggacttccaaagggagtcatgatctcg
catagtaacatcattgctggtataactgggatggcagaaaggattccagaactgggagag
gaagatgtctacattggatatttgcctctggcccacgttctggaattaagtgctgagctg
gtctgtctttctcatggatgccgcattggctactcttcaccacagactttagcagatcag
tcttcaaaaattaaaaaaggaagcaaaggggatacatccatgttgaaaccaacgctgatg
gcagcagttccggaaatcatggatcggatctacaaaaatgtcatgaataaagtgaatgaa
atgagtagttttcaacgtaatctatttattctggcctataattacaaaatggaacagatt
tcaaaaggacgtaatactccactgtgcaatagctttgttttccagaaagtccgaagcttg
ctagggggaaatattcgtctcctgttgtgtggtggtgctccactttctgcagccacacag
cgattcatgaacatctgtttctgctgtcctgttggtcagggatatggactcactgaatct
gctggggccggaacaattacagaagtgtgggactacaatactggcagagtgggcgcacca
ttagtttgctgtgaaatcaaattaaaaaactgggaggaaggtggatactttaatactgat
aaaccacaccccaggggtgaaattcttattgggggccaaaatgtgacaatgggatactac
aaaaatgaagcaaaaacaaaagctgatttctttgaagatgaaaatggacagaggtggctc
tgtactggggatattggagagtttgatcctgatggatgcttaaaaattattgatcgtaaa
aaggaccttgttaaactacaggcaggagaatatgtttcccttgggaaagtagaggcagct
ttgaaaaatcttccactagtagataacatttgtgcgtatgcaaacagttatcattcttat
gtcattggatttgttgtgccaaatcaaaaggaactaactgaactagctcgaaagaaagga
cttaaagggacttgggaagagctgtgtaacagttgtgaaatggaaaatgaggtacttaaa
gtgctttccgaagctgctatttcagcaagtctggaaaagtttgaaattccagtaaaaatt
cgtttgagccctgaaccgtggacccctgaaactggtctggtgacagatgccttcaagctg
aaacgcaaagagcttaaaacacattaccaggcggacatcgagcgaatgtatggaagaaaa
taa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044212
Entry
101044212         CDS       T04350                                 

Gene name
ACSL6
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04216  Ferroptosis
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101044212 (ACSL6)
   00071 Fatty acid degradation
    101044212 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101044212 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    101044212 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101044212 (ACSL6)
   03320 PPAR signaling pathway
    101044212 (ACSL6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101044212 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101044212 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101044212 (ACSL6)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101044212 (ACSL6)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101044212 (ACSL6)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101044212 (ACSL6)
  Exosomal proteins of breast cancer cells
   101044212 (ACSL6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101044212
NCBI-ProteinID: XP_010337293
UniProt: A0A2K6S2H1
LinkDB
Position
Unknown
AA seq 722 aa
MLTFFLVSGGSLWLFVEFVLSLLEKMQTQEILRILRLPELGDLGQFFRSLSATTLVSMGA
LAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQV
FRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQ
NRPEWIIAELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVER
KETPGLKLIILMDPFEETLKERGQKCGVVIKSMQAVEDCGQENHHVPVPPQPDDLSIVCF
TSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVY
CHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAK
RKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVY
EGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLADVEELNYWACKGEGEICVRGPNV
FKGYLKDPERTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIEN
IYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTSKDLKKAIL
EDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSI
SM
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgctgaccttcttcctcgtgtcggggggctccctctggctgttcgtggagtttgtcctc
tcacttctggagaagatgcagacacaggagatcctgaggattctgcggctgcctgagcta
ggcgacttgggccagtttttccgcagcctctcggccaccacccttgtgagtatgggtgcc
ctggccgccatcctcgcctactggttcactcaccggccaaaggctttgcagccaccatgc
aacctcctgatgcagtcagaagaagtagaggacagtggcggggcacggcgatctgtgatt
gggtctggccctcagctacttacccactactatgatgatgctcggaccatgtaccaggtg
ttccgccgtgggcttagcatctcagggaatgggccctgtcttggtttcaggaagcccaag
cagccttaccagtggctgtcctaccaggaggtggccgacagggctgaatttctggggtcc
ggacttctccagcacaattgtaaagcatgcacagatcagtttattggtgtttttgcacaa
aatcggccagagtggatcattgcggagctggcctgctacacatattccatggtggtggtc
ccactctatgacaccctgggccctggggcaatccgctacatcatcaatacagcggacatc
agcactgtgattgtggacaaacctcagaaggctgtgcttctgctagagcatgtggagagg
aaggagactccaggcctcaagctgatcatcctcatggatccgttcgaagaaaccctgaaa
gagagagggcagaagtgcggggtggtcattaagtccatgcaggctgtggaggactgtggc
caagagaatcaccatgttcctgtgcccccgcagcctgatgacctctccattgtgtgtttt
acaagtggcacaacagggaacccaaaaggtgcgatgctcacccatgggaacgtggtggct
gatttctcaggctttctgaaagtgacagagaaagtgatctttccgagacaggacgatgtg
ctcatctccttcctgcctctggctcacatgtttgagagagtaatccagtctgtcgtctat
tgccatggagggcgcgttggcttcttccagggagacatccgcctcctctcagatgacatg
aaggctctatgccccaccatcttccctgtggtgccacgactgctgaaccggatgtacgac
aagatcttcagccaggcaaacacaccattaaaacgctggctcctggagtttgcagcaaag
cgtaagcaagccgaggtccggagtgggatcatcaggaatgatagtatctgggatgaactc
ttctttaataagattcaggccagtcttggtgggtgtgtgcggatgattgttactggagca
gccccagcatcaccaacagttctgggatttctccgggcagctctagggtgccaggtttat
gaaggttatggccaaactgagtgcacagctggatgtaccttcaccacgcctggggactgg
acctcagggcatgtaggggcgccacttccctgcaatcacatcaagctcgctgatgttgag
gaactgaactattgggcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtg
ttcaaaggctacttgaaagatccagagaggacaaaggaggccctggacagtgacggctgg
cttcacactggagacatcgggaaatggctgccggcaggaactcttaaaattattgatcgg
aaaaagcacatatttaaacttgctcagggagaatatgttgcacccgagaagattgagaac
atctacatccggagccaacctgtagcgcaaatctatgtccatggggacagcttaaaggcc
tttttggtaggcattgttgtgcctgaccctgaagttatgccctcctgggcacagaagaga
ggaattgaaggaacatatgcagatctctgcacaagtaaggatctgaagaaagccattttg
gaagatatggtgaggttaggaaaagaaagtggactccattcttttgagcaggttaaagcc
attcacatccattctgacatgttctctgttcaaaatggcttgctgacaccaacactaaag
gctaaaagacctgagctgagagagtacttcaaaaaacaaatagaagagctttactcaatc
tccatgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049112
Entry
101049112         CDS       T04350                                 

Gene name
ACSBG2
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101049112 (ACSBG2)
   00071 Fatty acid degradation
    101049112 (ACSBG2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101049112 (ACSBG2)
   03320 PPAR signaling pathway
    101049112 (ACSBG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101049112 (ACSBG2)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101049112 (ACSBG2)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101049112 (ACSBG2)
SSDB
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Other DBs
NCBI-GeneID: 101049112
NCBI-ProteinID: XP_003938899
LinkDB
Position
Unknown
AA seq 649 aa
MNKTQVAPKLWTTCQDGEVLLRLSKHGPGHETPMTIPEFFQESVNRFGTYPALAFKNSEK
WEILNFNQYYKACWKAAKSLIKLGLERFHGVGILGFNSVEWFITALGTILAGGLCVGIYA
TNSAEACQHAITDAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQYRLPVKNSNNLYSW
DDFMELGGSIPDTQLEQVIQSQKANQCAVLIYTSGTTGMPKGVMLSHDNITWTAGAVAKD
LKLTEKHEMVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQPDALKGTLINTLKEVKPTVF
LGVPRIWEKMQVEVKKNSAKFTGLSKKVFVWARNIGFKINSKKMLGKHNTPMNYRMAKTL
VFSKVKMSLGLDHCHSFICGAAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNY
RLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDEEGWLHSGDL
GQLDSLGFLYITGRIKEILITAGAENVAPIPIETLVKKKIPIISNAMLVGDKLKFLGMLL
TLKCEINQMSGEPLDKLTLEAIDFCRGLGSLASTVTDIVKQKDSLVYKAIQEGINDVNQE
ATSNAQKIQKWVILEKDFSIYGGELGPTMKLKRHFIAQKYKKQIDGMYY
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaacaaaacacaagtagctcccaagctgtggactacctgccaggatggagaagtcctt
ctgaggctgtccaaacacggaccaggccatgagaccccgatgaccatccctgaatttttt
caagagtcagtcaaccgatttggaacttatccagccctcgcattcaagaacagtgaaaaa
tgggaaattctgaatttcaaccagtactacaaggcttgttggaaggctgcgaaatctttg
atcaaactgggcttggagcgtttccatggagttggcatcctggggtttaactctgtggag
tggtttatcactgctctcggcaccatcctagctgggggcctttgtgttggtatttatgcc
accaactctgccgaggcttgtcaacatgccatcactgatgccaaagtgaacatcttgctg
gttgagaatgatcaacagttacagaaaatcctttcgattccacagagcagtctggagccc
ctaaaagcgatcatccagtacagactgccagtgaagaacagcaacaatttgtactcttgg
gatgatttcatggaacttggcgggagcatccctgacacccaactggaacaggtcatccag
agccagaaagcgaatcagtgcgccgtgctcatctacacttcggggaccacaggcatgccc
aagggagtgatgctcagtcatgacaacatcacgtggacagcaggagcagtggcaaaggac
ttgaaactgacagaaaagcatgagatggtggtcagctacctcccactcagccacattgca
gcacagatgatggacatctgggtacccataaagattggagcactcacatactttgctcaa
ccagatgctctcaagggcaccttgataaatactctaaaggaggtaaagcctactgtcttc
ttgggagtgccccgaatttgggagaagatgcaagtggaagtgaagaaaaatagtgccaag
ttcacaggcttgagtaagaaggtatttgtgtgggcaagaaacattggcttcaagatcaac
tcaaaaaagatgttggggaaacataatactcccatgaactaccgcatggctaagactctt
gtgttcagcaaagtgaagatgtcccttggcttggatcactgtcactcttttatctgcggg
gctgcgcccctcaaccaagagactgccgagttctttctaagcttggacatacctataggc
gagttgtatgggttgagtgagagctcaggaccccacacaatatccaaccagaataactat
cggcttctaagctgcggcaagatcttgactgggtgtaagaacatgctgttccagcagaac
aaggatggcattggggagatctgcctctggggcaggcacatcttcatgggctatctggaa
agtgagactgaaactacagaggcaattgatgaggaaggctggctacactctggggatctg
ggccagctggacagtctgggtttcctctacatcactggccgcatcaaagaaatccttatc
actgccggtgctgaaaacgtggcccccattcccattgagaccttggttaagaagaagatc
cccatcatcagtaacgccatgttagtaggagataaactgaagtttctgggcatgttgctg
acgctgaagtgtgagatcaatcagatgagcggagaacctctggacaagctgaccttggag
gccatcgacttctgccggggtctgggtagcttggcatctaccgtgactgacattgtgaag
cagaaagactccctggtctacaaggccatccaggaaggcatcaatgatgtgaaccaggaa
gccacaagcaatgcgcagaagattcaaaagtgggtcatcttggagaaggacttttccatc
tatggtggagagctaggtccaacgatgaaacttaagagacattttatagcccagaaatac
aaaaaacaaattgatggaatgtactactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049877
Entry
101049877         CDS       T04350                                 

Gene name
ACSBG1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG1 isoform X1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00061  Fatty acid biosynthesis
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04920  Adipocytokine signaling pathway
Module
sbq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101049877 (ACSBG1)
   00071 Fatty acid degradation
    101049877 (ACSBG1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101049877 (ACSBG1)
   03320 PPAR signaling pathway
    101049877 (ACSBG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101049877 (ACSBG1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101049877 (ACSBG1)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101049877 (ACSBG1)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 101049877
NCBI-ProteinID: XP_010329124
UniProt: A0A2K6S2N2
LinkDB
Position
Unknown
AA seq 765 aa
MPRNSGAGYGCPHGDPGMPDSRETPQESRQDPSVGTSQENSKTRFLNRLPPGGPGCVHKL
SFVRNLQYRQGVRRCVRSRALHQPSSLTDGQPLSKESLNHALEFSVPEKVPKAQWDTPEE
ALWTTRADGQVRLRIDPGCAQPPYTVHRMFYEALDKYGDLRALGFKRQDKWEHISYSQYY
LLSRRAAKGFLKLGLERAHSVAILGFNSPDWFFSAVGTVFAGGIVTGIYTTSSPEACQYI
AHDCRANVIVVDTQKQLEKILKIWKQLPHLKAVVIYKESPPNKMSHVYTMEEFMELGNEV
PEEALDAIIDAQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQQ
EVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVW
EKIMERIQEAAAQSGFIRRKMLLWAMSVTLEQNLTCAGSDLKPFTTRLADYLVLAKVRQA
LGFAKCQKSFYGAAPMTAETQHFFLGLNMRLYAGYGLSETSGPHFMSSPYNYRLYSSGKV
VPGCRVKLVNQDAEGIGEICLWGRTVFMGYLNMEDKTCEAIDEEGWLRTGDAGRLDADGF
LYITGRLKELIITAGGENVPPLPIEEAVKTELPIISNAMLIGDQRKFLSMLLTLKCTLDP
ETSDPTDNLTEQAVEFCQRVGSRATTVSEIVGRKDEAVYQAIEEGIRRVNMNAAARPYHI
QKWVILERDFSISGGELGPTMKLKRLTVLEKYKDIIDSFYQEQTM
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgccacgcaattctggagctggatacggctgcccccacggggaccccggcatgccggac
agcagagagaccccacaggagagccggcaggacccaagtgtggggacctcccaagaaaat
tcgaaaaccaggttcttaaacagactgccgccgggtgggcctggctgtgttcacaaactt
agttttgttcggaacctgcagtaccgacaaggagtgaggcggtgtgtgcgaagcagggcc
ctccaccaacccagctcactgactgatgggcagccgctctccaaagagtccctgaaccat
gctctcgagttttccgtgccagagaaggtacccaaggcccagtgggacactccagaggag
gcgctgtggacgactcgggctgatgggcaggtgcgcctccgcatagaccccggctgcgca
caacctccctacaccgtgcatcggatgttctatgaggccctggacaagtacggggacctc
cgcgctctgggcttcaagcgccaggacaagtgggagcacatctcctactcccagtactac
ctgctctcccgcagagccgccaagggcttcctgaagctcggcctggagcgggcccacagc
gtggccatcctcggcttcaactccccggactggttcttctcggcagtgggcacagtattc
gcaggtggcatcgtcactggcatctacaccaccagctcccccgaggcctgccagtacatc
gcccatgactgccgcgccaacgtcattgtggtggacacgcagaagcagctggaaaagatc
ctgaagatctggaaacagttgccgcatctaaaggcagtcgtgatatacaaagaatctcct
ccaaacaagatgagccacgtgtacacgatggaggaattcatggagctggggaatgaagtg
cctgaggaagccctggacgccatcatcgacgcccagcagcccaaccagtgctgtgtgctg
gtctacacgtcaggcaccactggaaaccccaagggtgtgatgctgagtcaggacaatatc
acgtggacggcgcggtacgggagccaggccggcgacatccagccagcggaagtgcagcag
gaggtagtggtcagctacctgcccctcagccacattgctgcccagatctacgacctgtgg
acgggcatccagtggggggcccaggtctgctttgccgaacccgacgccctgaaggggagc
ctggtgaacacgctgcgggaggtggagcccacgtcgcacatgggggtgccccgggtgtgg
gagaagatcatggagcgcatccaggaggcagcggctcagtctggcttcatccggcgcaag
atgctgctgtgggccatgtcggtgaccttggagcagaacctcacctgtgctggcagcgac
ctgaagcccttcaccaccagactggcagattacctggtgctggccaaggtccgccaggca
ctgggctttgccaagtgtcagaagagcttctatggagcggcccccatgacggcagagaca
cagcacttcttcctgggcctcaacatgcgcctgtacgcgggctacggcctcagtgagacc
tcagggccccacttcatgtccagcccctacaactaccggctgtacagctcaggcaaggtg
gtgcccggctgtcgggtgaagctggtgaaccaggatgcagagggcattggcgagatctgc
ctgtggggccgcaccgtcttcatgggctacctgaacatggaggacaagacatgtgaagcc
atcgatgaggaaggctggctgcgcacgggcgacgctggccgcctggatgccgacggcttc
ctctatatcactgggcgcctcaaagaattaatcatcacagctggtggggagaacgtgccc
cctttgcccatcgaggaggccgtgaagacggagctgcccatcatcagtaacgccatgctg
atcggggaccagagaaagttcctgtccatgctgctcaccttgaagtgcactctggaccca
gagacctctgacccgactgataatctgaccgaacaagctgtggagttctgccagcgggtg
ggcagcagagccaccacagtgtccgagatcgtggggaggaaggatgaggccgtgtaccag
gccatcgaagaggggatccggagggtcaacatgaacgcggcggcccggccctaccacatc
cagaagtgggtgattctcgagagagacttctccatttcgggtggagagctgggtcccaca
atgaagctgaaacggctcacggttttggagaagtacaaagatatcattgactccttttac
caagagcaaacaatgtga

DBGET integrated database retrieval system