KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028662
Entry
101028662         CDS       T04350                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05145  Toxoplasmosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101028662 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101028662 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101028662 (TYK2)
   04658 Th1 and Th2 cell differentiation
    101028662 (TYK2)
   04659 Th17 cell differentiation
    101028662 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101028662 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101028662 (TYK2)
   05160 Hepatitis C
    101028662 (TYK2)
   05171 Coronavirus disease - COVID-19
    101028662 (TYK2)
   05164 Influenza A
    101028662 (TYK2)
   05162 Measles
    101028662 (TYK2)
   05168 Herpes simplex virus 1 infection
    101028662 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101028662 (TYK2)
   05169 Epstein-Barr virus infection
    101028662 (TYK2)
   05165 Human papillomavirus infection
    101028662 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101028662 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101028662 (TYK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101028662 (TYK2)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101028662 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Jak1_Phl Pkinase FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 101028662
NCBI-ProteinID: XP_010347979
LinkDB
Position
Unknown
AA seq 1006 aa
MPAKPPAGNMPLCHRGTARGSKPVGDGAQTMATMGGLKVLLHWAGRGGGEPWVTFSESSL
TAEEVCIHIAHKLGESGGKYEFVNDVASLWELSSEEEIHHFKNESLGMAFLHLCHLALHR
GVPLEEVAKKTSFKDCIPRSFRQQIQQHNALTRLRLRNVFRRFLRDFQPGRLSQQMVMVK
YLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGEAPTDPGPESAAGPPTHEVLV
TGTGGIQWWPVQEEVSKEKGSIRGSGRNLQASLSGKKAKAHEAIAQPADKPREPPRVYFC
DFRDITHVVLKECRVGIHRQDNKCLELSLPSRAMALSFVSLVDGYFRLTADSSHYLCHEV
APPRLVMSIQDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQRSQARDGMQ
SLQLRKFPIEQQAGAFMLEGWGRSFSSVRELGAALRGCSLKAGDDCFSLRRCCLPQPGET
SNLIIMRGAQASTRPLNLSQLSFHRVDQKEITQLSHLGQGTRTNVYEGRLRVEGSGGPEE
GKMDEEVPLGPHRDCGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHVHLAFVHGVCV
RGPESDPLFRPSQENKNLVHGNVCGRNILLARLGLEEGTSPFIKLSDPGVGLGALSREEC
VERIPWMAPECLSGGPNSLRTATDKWGFGATLLEICFDGEAPLQNCSPSEKERFYQRQHR
LPQPSCPELATLTGQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNLDSPASDPTVF
HKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILR
TLYHEHIVKYKGCSEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMA
YLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPEC
LKEYKFYYASDVWSFGVTLYELLTHCASSQSPPTVRARPAASPGVC
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgcccgccaagccacctgccgggaacatgcctctgtgccatcggggaacagctaggggc
agcaagcctgttggggatggagcccagaccatggctaccatgggaggcctgaaggtgctt
ctgcactgggctggtcgaggcggcggggagccctgggtcaccttcagcgagtcatcgctg
acagctgaggaagtctgcattcacatcgcacataaactcggtgagtccgggggcaagtat
gagtttgtgaatgacgtggcatcactgtgggagctgtcgagcgaggaggagatccaccac
tttaagaatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccaccgt
ggcgttcccctggaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctcc
ttccgtcagcagatccagcagcacaatgctctgacccggctgcgccttcggaacgtcttt
cgcaggttcctacgggacttccagccgggccgcctctcccagcagatggtcatggttaaa
tatctggccacgctcgagcggctggcaccccgctttggcacagagcgtgtgcctgtgtgc
cacctgaggctgctggctcaggctgagggggagccctgctacatacgggacagtggggag
gcccctacagaccctggccctgagtctgctgctgggccccccacccatgaggtgctggta
acaggcactggtggcatccagtggtggccagtacaggaggaggtgagcaaagagaagggt
tctatcaggggcagcggcaggaatctgcaagccagcctgtctgggaagaaagccaaggct
cacgaggcaatcgcccagccagcggacaagccaagggagccgcctcgggtctacttctgt
gacttccgagacatcacccacgtggtgctgaaagagtgccgtgtcggcatccaccggcag
gacaacaagtgcctggagctgagcctgccttctcgggctatggcgctgtccttcgtgtca
ttggtggacggctatttccgcctgacagctgactccagccactacctgtgccatgaggtg
gctcccccacggctggtgatgagcatccaggacgggatccacggacccctgctggagcca
tttgtgcaggccaagctgcggcccgaggatggcctctaccttattcactggagcaccagc
cacccctatcgcctgatcctcacggtggcccagcgtagccaggcacgagatggcatgcag
agcttgcagctccggaagttccccattgagcagcaggctggggccttcatgctggagggc
tggggccggtccttctccagcgttcgggaacttggggctgctttgcggggctgctcactg
aaagcgggggatgactgcttctctctacgtcgctgttgcctgccccaaccaggagaaacc
tccaacctcatcatcatgcggggggctcaggctagcaccaggccactcaacctcagccag
ctcagcttccaccgggtcgaccagaaggagatcacccagctgtcccacttgggccagggc
acaaggaccaatgtgtatgagggccgcctgagagtggagggcagtgggggccctgaggag
ggcaagatggacgaagaggtccccctcgggccccacagagactgtgggcaggagctgcga
gtggtccttaaagtgctggatcctagtcaccatgacattgccctggccttctatgagaca
gccagcctcatgagccaggtctcccacgtgcacctggccttcgtgcatggcgtctgtgtg
cgcggccctgaaagtgaccccctcttccgcccatcccaggagaacaagaacctggttcat
ggtaatgtgtgtggccggaacatcctgctggcacgtctggggctggaggagggcaccagc
cccttcatcaagctgagtgatcccggcgtgggcctgggtgccctctccagggaggagtgt
gtggaacggatcccctggatggcccccgagtgcttgtcaggcgggcccaacagcctacgc
actgccacggacaagtggggctttggtgccaccctcctcgagatctgctttgatggagag
gcccccctccagaactgcagcccctccgagaaagagcgtttctaccagaggcagcaccgg
ctgccccagccctcctgtccagagctggccacactcactggccagtgtctgacctatgag
ccaacccagaggccgtcattccgcaccatcctgcgtgacctcacccggctgcaaccccac
aatcttgctgatgtcttgactgtgaacctggactcacctgcgtcagatcctactgttttc
cacaagcgctatttgaaaaagatccgagatctgggcgagggccactttggtaaggtcagc
ttgtactgctatgatcccaccaacgacggcactggcgagatggtggcagtgaaagccctc
aaggcagactgcggcccccagcaccgctcaggctggaagcaggagattgacattctgcgc
acgctctaccacgagcacatcgtcaagtacaagggctgcagcgaggaccaaggcgagaag
tcggtgcaactggtcatggagtacgtgccactgggcagcctccgagactacctgccccgg
cacagcgtcgggctggcccagctgctgctgttcgcccagcagatctgcgagggcatggcc
tatctgcacgcgcagcactacatccaccgagacctagccgcgcgcaacgtgctgctggac
aacgacaggctggtcaagatcggggactttggcctagccaaggccgtgcccgaaggccac
gagtactaccgtgtgcgcgaggatggggacagccccgtgttctggtatgccccagagtgc
ctgaaggagtataaattctactatgcgtccgatgtctggtccttcggggtgaccctgtat
gagctgctgacgcactgtgcctccagccagagccccccaacggtgagagccaggcccgca
gcctcacctggagtttgctag

DBGET integrated database retrieval system