KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028764
Entry
101028764         CDS       T04350                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05100  Bacterial invasion of epithelial cells
sbq05214  Glioma
sbq05220  Chronic myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101028764 (SHC3)
   04014 Ras signaling pathway
    101028764 (SHC3)
   04072 Phospholipase D signaling pathway
    101028764 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101028764 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101028764 (SHC3)
   04062 Chemokine signaling pathway
    101028764 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101028764 (SHC3)
   04915 Estrogen signaling pathway
    101028764 (SHC3)
   04917 Prolactin signaling pathway
    101028764 (SHC3)
   04926 Relaxin signaling pathway
    101028764 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    101028764 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101028764 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101028764 (SHC3)
   05226 Gastric cancer
    101028764 (SHC3)
   05214 Glioma
    101028764 (SHC3)
   05220 Chronic myeloid leukemia
    101028764 (SHC3)
   05224 Breast cancer
    101028764 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    101028764 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101028764 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101028764 (SHC3)
   01522 Endocrine resistance
    101028764 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101028764
NCBI-ProteinID: XP_010347122
LinkDB
Position
Unknown
AA seq 558 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSAMNAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYL
GCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQF
AGMSISLTISTASLNLRTPDSKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRAC
HILECCDGLAQDVIGSIGQAFELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHP
YYNSIPSKMPPPGGFLDARLKPRPHTSDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPFRQ
SERQGSLDIYSMPEGKLHVASTGEAPTYVNTQQIPLQAWPAVVSSAESSPRKDLFDMKPF
EDALKNQPLGPMLSKAASVECISPVSPRAPDAKMLEELGAETWYQGEMSRKEAEGLLEKD
GDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLP
IVSAGSELCLQQPVERKQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagtctgtcggtgagcggcggcggaggcaaggtctcggcggcgcgcgcgacc
ccggcggcggctccctacttggtgtccggcgaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctccgcc
atgaacgccgccaggaaaggccggccaggcgacgagccgctgcccaggccccctcggggg
gcgccgcacgccagcgaccaggtgctggggcccggagtcacctacgtggtcaagtacctg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgtgtctgtgaagctgtgcctggtgccaagggagccttcaag
aagagaaagcctccaagcaaaatgctgtccagcatcttgggaaagagcaatctccagttt
gcgggaatgagcatctctctgaccatctccactgccagtctgaacctgcgaactccggac
tccaaacagatcatagcaaatcaccacatgcggtccatctccttcgcctctgggggagac
ccggacacaactgattatgtcgcatacgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgcgatgggctggcccaggatgtcatcggctccataggacaagcc
tttgagctccgatttaagcagtatttgcagtgtcctaccaagattcctgctctccatgac
cgaatgcagagtctggatgaaccatggacggaagaggagggagatggctcagaccacccg
tattacaacagcatcccaagcaagatgcctcctccagggggctttcttgatgctcgactg
aaacccagaccccacacttctgacacagctcagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacctttggcgaagactggcagcaaacgcctttcaggcaa
agtgagaggcaagggtccttggacatctacagcatgccagaaggaaaactgcacgtggcc
tccacgggagaagcacccacctacgtcaacacccagcagatcccactgcaggcctggcca
gctgtggtcagcagcgctgagagcagcccgaggaaagacctctttgacatgaaacctttt
gaagatgctctcaagaaccaacccttggggcccatgttgagcaaggcagcctctgtggag
tgtatcagccctgtgtcacccagagccccggatgccaagatgctggaggagctgggagcc
gagacttggtaccaaggagagatgagcaggaaggaggcagaggggctgctggagaaagat
ggagacttcctggtcaggaagagcaccactaatccaggctccttcgtcctcacgggcatg
cacaacggccaggccaagcacctgctgctcgtggacccggaaggcacgatccggacaaag
gacagagtcttcgacagtatcagccacctcatcaaccaccatctagagagtagcctgccc
atcgtctctgcagggagcgagctgtgcctccagcagccagtggagaggaagcagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032627
Entry
101032627         CDS       T04350                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05100  Bacterial invasion of epithelial cells
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05220  Chronic myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101032627 (SHC4)
   04014 Ras signaling pathway
    101032627 (SHC4)
   04072 Phospholipase D signaling pathway
    101032627 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101032627 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101032627 (SHC4)
   04062 Chemokine signaling pathway
    101032627 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101032627 (SHC4)
   04915 Estrogen signaling pathway
    101032627 (SHC4)
   04917 Prolactin signaling pathway
    101032627 (SHC4)
   04926 Relaxin signaling pathway
    101032627 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    101032627 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101032627 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101032627 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101032627 (SHC4)
   05226 Gastric cancer
    101032627 (SHC4)
   05214 Glioma
    101032627 (SHC4)
   05220 Chronic myeloid leukemia
    101032627 (SHC4)
   05224 Breast cancer
    101032627 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    101032627 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101032627 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101032627 (SHC4)
   01522 Endocrine resistance
    101032627 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 101032627
NCBI-ProteinID: XP_003928928
UniProt: A0A2K6S4B0
LinkDB
Position
Unknown
AA seq 628 aa
MRESGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKGSPQPPH
PTLAPHLPAEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSSPSSPETSLSGSGTAPPLQPDLVGHRATALTPDSCPLPRPREPPLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECQNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
RVDSQAEEREDHEYYNEIPGKQPPVGGVSDVRIRVQATEHMAYCPIRCEKLCYLPGNSKC
SSVYENCIEQSRGLGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTLGSAGN
QTQPLGSPWHCGKAPETVQPGAAAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVK
DGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSL
PIISSGSEVSLKQPVRKDNNPGVLHSNK
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgagaaagcggccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcaatcacgtcc
ttggacgaaggtagccccggaggctcggtcgggaacaagggctccccgcagcctccccac
cccaccctggcacctcacctgccggctgaagatgccaccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcgagcatgaagctggccaacccggccact
ttgctgagtctgaaaaacttttgcctgggcaccaaagaggtgcctcgactgaagctccag
gaaagccgggacccaggttccagcagcccgtcatccccagaaaccagtctaagtgggtcc
gggactgcacctccactgcagccggacctggtgggccacagggcaaccgccttaacccct
gattcgtgtccacttcctcgccctagggagccaccccttaggagcaggcaggacaggcac
tttctacagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtctctggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacggttcttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacactgatgaatcttgacaaccaacag
attattgctaatcatcatatgcagtctatttcatttgcctctggaggagatcctgacact
acagactacgttgcctatgtagctaaagatcctgttaatcaacgagcctgtcacatattg
gaatgccaaaatggaatggcccaagatgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
cgtgtggatagccaagctgaggagagagaagatcatgaatattataatgaaattccaggg
aagcagccaccagtaggtggcgtttccgacgtgcggatcagagttcaagccacggaacat
atggcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtatagaacaaagcaggggactaggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacatgccgagtggatctcttc
gacgacccctgctacattaatacacaggctcttcaaagtacgcttggctctgctggaaat
cagacccaaccactgggcagcccgtggcactgtggaaaggcaccagaaactgttcagccg
ggtgctgcggcccagcctgccagctcacattctttgccacacattaagcagcagctgtgg
agtgaagaatgctaccatggcaagctgagcaggaaggcggcagagagcctcttggtaaag
gatggggactttctggttcgagagagtgcaacatcccctggccaatatgtgctgagtgga
ctacagggaggccaagcaaaacatcttctcctggtggatcctgaaggcaaggtgaggacc
aaggatcacgtatttgataatgttggccaccttatcagataccatatggataacagtttg
ccaatcatctcttctggaagcgaagtaagccttaaacaaccagtgagaaaagataataat
ccaggagttttgcattccaacaaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038895
Entry
101038895         CDS       T04350                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05100  Bacterial invasion of epithelial cells
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05220  Chronic myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101038895 (SHC1)
   04014 Ras signaling pathway
    101038895 (SHC1)
   04072 Phospholipase D signaling pathway
    101038895 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101038895 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101038895 (SHC1)
   04062 Chemokine signaling pathway
    101038895 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101038895 (SHC1)
   04915 Estrogen signaling pathway
    101038895 (SHC1)
   04917 Prolactin signaling pathway
    101038895 (SHC1)
   04926 Relaxin signaling pathway
    101038895 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    101038895 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101038895 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101038895 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101038895 (SHC1)
   05226 Gastric cancer
    101038895 (SHC1)
   05214 Glioma
    101038895 (SHC1)
   05220 Chronic myeloid leukemia
    101038895 (SHC1)
   05224 Breast cancer
    101038895 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    101038895 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101038895 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101038895 (SHC1)
   01522 Endocrine resistance
    101038895 (SHC1)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101038895
NCBI-ProteinID: XP_010346906
LinkDB
Position
Unknown
AA seq 391 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGPKGEPGRAADDGEGIVGAAMPDSSPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVCYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTISTSS
LNLMAADCKQQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDH
QYYNDFPGKEPLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESV
SHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccacccccccggaggagctgccttccccgtcagcctca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactaccctctgctcc
ttcttcccgcggatgagcaacctgaggctggccaacccggctggggggcgccccgggcct
aagggggagccaggaagggcagccgatgatggggaggggatcgtaggcgcagccatgcca
gactcaagccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacacggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tgctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
ggaaggagtaacctgaaatttgctggaatgccaatcactctcaccatctccaccagcagc
ctcaacctcatggccgcagactgcaagcagcaggatgtcatcagcaccattggccaggcc
ttcgagttgcgcttcaaacaatacctcaggaacccacccaaactggtcacccctcatgac
aggatggctggctttgatggctcagcttgggatgaggaggaggaagagccacctgaccat
cagtactataatgacttcccggggaaggaacccctcaacggggacttcctggtgcgggag
agcacgaccacacctggccagtatgtgctcactggcttgcagagtgggcagcccaagcat
ctgctgctggtggaccctgagggtgtggttcggacaaaggatcaccgctttgagagtgtc
agccacctcatcagctaccacatggacaatcacttgcccatcatctctgcgggcagcgaa
ctgtgtctacagcaacctgtggagcggaaactgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047748
Entry
101047748         CDS       T04350                                 

Definition
(RefSeq) SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05100  Bacterial invasion of epithelial cells
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05220  Chronic myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101047748
   04014 Ras signaling pathway
    101047748
   04072 Phospholipase D signaling pathway
    101047748
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047748
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101047748
   04062 Chemokine signaling pathway
    101047748
  09152 Endocrine system
   04910 Insulin signaling pathway
    101047748
   04915 Estrogen signaling pathway
    101047748
   04917 Prolactin signaling pathway
    101047748
   04926 Relaxin signaling pathway
    101047748
   04935 Growth hormone synthesis, secretion and action
    101047748
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101047748
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101047748
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101047748
   05226 Gastric cancer
    101047748
   05214 Glioma
    101047748
   05220 Chronic myeloid leukemia
    101047748
   05224 Breast cancer
    101047748
  09165 Substance dependence
   05034 Alcoholism
    101047748
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101047748
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047748
   01522 Endocrine resistance
    101047748
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 101047748
NCBI-ProteinID: XP_003939251
LinkDB
Position
Unknown
AA seq 411 aa
MGCVEVLQSMRALDFNTGTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLK
FAGMPITLTISTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAECVAYVAKDPVNQRA
CHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPD
HQYYNDFPGKEPPLGGVVDMRLREGATPPTAQTPSHLGAALPIGQPVGGDPEVRKQMPLP
PPCPAGRELFDDPSYVNVQNVDKARQAGGGAGPPNPAINGSTPRDLFDMKPFEDALRVPP
PPQSVTMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKH
LLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgggctgtgtggaggtcctgcagtcaatgcgtgccctggacttcaacaccgggactcag
gtcaccagggaggccatcagtctggtgtgtgaggctgtgccgggtgctaagggggcgaca
aggaggagaaagccctgtagccgcccgctcagctctatcctgggaaggagtaacctgaaa
tttgctggaatgccaatcactctcaccatctccaccagcagcctcaacctcatggccgca
gactgcaagcagatcatcgccaaccaccacatgcaatctatctcatttgcatccggcggg
gatccggacaccgctgagtgtgtcgcctatgttgccaaagaccctgtgaatcagagagcc
tgccacattctggagtgtcctgaagggcttgcccaggatgtcatcagcaccattggccag
gccttcgagttgcgcttcaaacaatacctcaggaacccacccaaactggtcacccctcat
gacaggatggctggctttgatggctcagcttgggatgaggaggaggaagagccacctgac
catcagtactataatgacttcccggggaaggaaccccctcttgggggggtagtagacatg
aggcttcgggaaggagccactccacccactgcccagacccccagccacttgggagctgca
ctgcctataggacagcctgttggaggagatccagaagtccgaaaacagatgccacttcca
ccgccctgtccagcaggcagagagctctttgatgatccctcctatgtcaatgtccagaac
gtagacaaggcccggcaagcagggggtggtgctgggcccccgaatcctgccatcaatggc
agcacaccccgggacctatttgacatgaagccctttgaagatgctcttcgggtgcctcca
cctccccagtcggtgactatggctgagcagctccgaggggagccctggttccatgggaag
ctgagccgacgggaggccgaggcactgctgcagctcaacggggacttcctggtgcgggag
agcacgaccacacctggccagtatgtgctcactggcttgcagagtgggcagcccaagcat
ctgctactggtggaccctgagggtgtggttcggacaaaggatcaccgctttgagagtgtc
agccacctcatcagctaccacatggacaatcacttgcccatcatctctgcgggcagcgaa
ctgtgtctacagcaacctgtggagcggaaactgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048523
Entry
101048523         CDS       T04350                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05100  Bacterial invasion of epithelial cells
sbq05214  Glioma
sbq05220  Chronic myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101048523 (SHC2)
   04014 Ras signaling pathway
    101048523 (SHC2)
   04370 VEGF signaling pathway
    101048523 (SHC2)
   04072 Phospholipase D signaling pathway
    101048523 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101048523 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101048523 (SHC2)
   04062 Chemokine signaling pathway
    101048523 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101048523 (SHC2)
   04915 Estrogen signaling pathway
    101048523 (SHC2)
   04917 Prolactin signaling pathway
    101048523 (SHC2)
   04926 Relaxin signaling pathway
    101048523 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    101048523 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101048523 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101048523 (SHC2)
   05226 Gastric cancer
    101048523 (SHC2)
   05214 Glioma
    101048523 (SHC2)
   05220 Chronic myeloid leukemia
    101048523 (SHC2)
   05224 Breast cancer
    101048523 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    101048523 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101048523 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101048523 (SHC2)
   01522 Endocrine resistance
    101048523 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101048523
NCBI-ProteinID: XP_003944956
LinkDB
Position
Unknown
AA seq 434 aa
MYMGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPGVRGSWKRKAPNKALASVLGKSNL
RFAGMSISVHISTDGLSLSVPATRQVIATHHMPSISFASGGDTDMTDYVAYVAKDPINQR
ACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKVALPPERPVGPEESAWGDEEEAAE
HNYYNSIPGKEPPPGGLVDSRLALMQPCALAALGQGPSPARRDARSLPWDVGHTGTAPPG
DGYVQADARGPLDPEEHLYVNTQGLDAPEPEDTAPLQPKDSPKKDLFDMRPFEDALKLHE
CSAAVVTAAPVPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERLLRADGDFL
VRDSITNPGQYVLTGMHAGRPKHLLLVDPEGAVRTKDVLFESISHLIDHHLQNGQPIVAA
ESELHLRGVVSREP
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtacatgggctgcatcgaggtcctccgctccatgcgctccctggacttcagcacgcgc
acccaggtgaccagggaagccatcaaccgtctccacgaggctgtgcctggggtccgggga
tcctggaagagaaaggcccccaacaaggcgctggcttccgtcctgggcaagagcaacctt
cgctttgccggtatgagcatctctgtccacatctccaccgacggcctcagcctctctgtg
cccgccacgcgccaggtcatcgccacccaccacatgccatccatctccttcgcatcaggc
ggagacacggacatgacggattacgtggcctacgtcgccaaggaccccatcaaccagaga
gcctgccacatcctggagtgctgcgagggcctggcgcagagcgttatcagtaccgtgggc
caagcctttgagctgcgcttcaagcaatacctgcacagcccgcccaaggtggccctgccc
ccggaaaggccggtggggccggaggagtcggcctggggggacgaggaagaggccgcggag
cacaattactacaacagcatccctgggaaggagccgccgccgggcgggctggtggactcc
aggctggcgctgatgcagccctgcgccctcgccgccctcggtcagggcccatctcctgct
cgaagagacgcccgcagcttgccatgggacgtggggcacacgggtacagctccgccaggg
gacggctatgtgcaggcggacgcccggggccccctggaccctgaggagcacctgtacgtc
aacacccagggtctggacgcccccgagccggaggacacggcgcccctgcagcccaaggac
agccccaagaaggatctgtttgatatgcgaccctttgaggatgccttgaagctgcatgag
tgctcagcggccgtggttacggcagcccccgttcccttggaggaccagtggcccagcccc
cccacccgccgggccccagtggcccccacagaggagcagctgcggcaggagccctggtac
catggccggatgagccgccgggcggcagagaggctgctccgcgcagacggggacttcctg
gtgcgggacagcatcaccaaccccgggcagtacgtcctcaccggcatgcacgcggggcgg
cccaagcacctgctgctggtggaccctgagggcgcggtgcggacgaaggacgtgctgttt
gagagcatcagccacctgatcgaccaccacctccagaacgggcagcccatcgtggcggcg
gagagcgagctgcacctgcgcggcgtggtctcccgggagccctga

DBGET integrated database retrieval system