KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028835
Entry
101028835         CDS       T04350                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq04310  Wnt signaling pathway
sbq04330  Notch signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101028835 (DVL2)
   04330 Notch signaling pathway
    101028835 (DVL2)
   04390 Hippo signaling pathway
    101028835 (DVL2)
   04150 mTOR signaling pathway
    101028835 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101028835 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101028835 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101028835 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101028835 (DVL2)
   05226 Gastric cancer
    101028835 (DVL2)
   05217 Basal cell carcinoma
    101028835 (DVL2)
   05224 Breast cancer
    101028835 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101028835 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    101028835 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101028835 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101028835 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 101028835
NCBI-ProteinID: XP_003929187
UniProt: A0A2K6T4G1
LinkDB
Position
Unknown
AA seq 736 aa
MAGSSTGGGGIGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPSGTGDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcactgggggcggtgggattggggagaccaaggtgatttaccacctg
gatgaagaagagactccctacctggtgaagatccctgtccctgccgagcgcatcaccctc
ggcgatttcaagagcgttctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatcctcagcccgagatggct
cctccagcccatgaacctcggacagaactggcgcctccagccccacctttaccacctttg
ccacctgagaggaccagtggcattggggactcgaggcctccatcctttcaccctaatgta
tccagcagccacgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgaaggagagacagcagtgagcatggcgctgggggccacaggaccggt
ggcccctcaaggctggagcgccacctggctggatatgagagctcctctaccctcatgacc
agcgagctggagagtaccagcctgggggactcggatgaggaggataccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctcctgaagcgccaccggcggcggagg
aaacagcggccaccccgcctggagaggacctcatccttcagcagcgtcacggattccaca
atgtctctgaatatcatcacagtcacactgaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagcaatgagcggggagatggaggcatctacattggttccatcatg
aagggtggggccgtggcagccgacgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaatgatgacgccgtgcgggtgctgagggacatc
gtgcacaagcctggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcctacttcaccctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccactctgcggctctgactggcaccttcccagcctacccaggctcctcctccatgagc
accattacatcaggatcctctttgcctgatggctgtgagggccggggtctctccatccac
acagacatggcatcagtcacgaaggccatggcagctccagagtctgggctggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcttttctgggctcggatgtggttgac
tggctctaccatcatgtggagggctttccagagcggcgggaggcccgaaaatacgccagc
gggctgctcaaagccggcctcatccgacacaccgtcaacaagatcaccttctctgagcag
tgctattatgtcttcggagacctcagtggtggctgtgagagctacctagttaacctgtct
ctcaatgacaacgacggctccagtggggcttcagaccaggacaccctggcccctctgcct
ggggccacgccctggcccctgctgcccactttctcctaccagtacccagccccacacccc
tacagcccgcagcccccaccctaccatgagctttcgtcttatacctatggtgggggcagt
gccagcagccagcacagtgagggcagccggagcagtgggtcgacacgaagtgatgggggg
gcagggcgcacggggaggcctgaggagcgggcccccgagtccaagtccggcagtggcagt
gagtccgagccttccagccgagggggcagccttcggcggggtggggaaccaagtgggact
ggcgatgggggtcctcctccctccagaggctcaactgggggtgcccctaatctccgagcc
cacccggggctccatccctatggaccaccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacccccacccccagtccctccagcagtgcagcctccaggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagtgagttctttgtggatgttatgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035529
Entry
101035529         CDS       T04350                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1
  KO
K02353  segment polarity protein dishevelled
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq04310  Wnt signaling pathway
sbq04330  Notch signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101035529 (DVL1)
   04330 Notch signaling pathway
    101035529 (DVL1)
   04390 Hippo signaling pathway
    101035529 (DVL1)
   04150 mTOR signaling pathway
    101035529 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101035529 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101035529 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035529 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101035529 (DVL1)
   05226 Gastric cancer
    101035529 (DVL1)
   05217 Basal cell carcinoma
    101035529 (DVL1)
   05224 Breast cancer
    101035529 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101035529 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    101035529 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101035529 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101035529 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 101035529
NCBI-ProteinID: XP_010348663
LinkDB
Position
Unknown
AA seq 686 aa
MDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEILDDNAK
LPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRD
GVDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSTSTALSSELESS
SFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSITDSTMSLNI
VTVTLNMDRHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNF
ENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAA
LTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVRAMQLPDSGL
EIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITF
SEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPTAPWPLGQGYPYQYPGPPPCF
PPAYQDPGFSYGSGSTGSQQSEGSRSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAP
SGVGSSWRECPAGQLSRGSSPRSQASSTAPGLPTPHPVTKAYTVVGGPPGGPPVRELAAV
PPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggacgaggaggagacgccgtacctggtcaagctgcccgtggcgcccgagcgcgtcacg
ctggccgacttcaagaacgtgctcagcaaccggccggtgcacgcctacaaattcttcttc
aagtccatggaccaggacttcggggtggtgaaggaggagatcttggacgacaatgccaag
ctgccctgcttcaacggccgcgtggtctcctggctggtcctggccgagggtgctcactca
gatgccggctcccagggcacggacagccacacagacctgcctccgcctcttgagcggaca
ggtggcatcggggactcccggcccccctccttccacccgaacgtggccagcagccgtgat
ggggtggacaatgagacgggcacggagtccatggtcagccaccggcgggagcgcgcccga
cgccggaaccgcgaggaggctgcccggaccaatgggcacccaaggggagaccggcggcgg
gacgtggggctgcccccagacagcacgtccactgccctgagcagcgagctcgagtccagc
agctttgtggactcagatgaggatggcagcacgagcaggctgagcagctccacggagcag
agcacgtcatccaggctgatccggaagcacaagcgccggcggaggaagcagcgcctgcgg
cagacggaccgggcctcctccttcagcagcattacggactccaccatgtctctcaacatt
gtcaccgtcacgctcaacatggacagacaccacttcctgggcatcagcatcgtggggcag
agcaacgatcgtggagatggcggcatttacataggttccatcatgaagggcggggcagtg
gccgctgacggccgcattgagcccggggacatgctgctgcaggtaaacgatgtgaacttc
gagaacatgagcaacgacgacgctgttcgggttctgcgggagatcgtgtcccagacgggg
cccatcagccttaccgtggccaagtgctgggacccaacgccccgaagctactttactgtc
ccaagggctgacccggtgcggcccatcgaccctgccgcctggctgtcccacaccgcggca
ctgacgggagccctgccccgctacggtacgagcccctgctccagcgccgtcacgcgcacc
agctcctcctcactaaccagctccgtgcctggtgctccgcagctggaggaggcgccgctg
acagtgaagagtgacatgggtgccgtcgtgcgggccatgcagctgccggactcgggactg
gagattcgtgaccgcatgtggctcaagatcaccattgccaacgccgtcatcggagcggac
gtggtggactggctgtacacacacgtggagggcttcaaggagcggcgggaggcccggaag
tatgccagcagcttgctgaagcacggcttcctgcggcacacggtcaacaagatcaccttc
tccgagcagtgctactacgtcttcggggacctgtgtagcaatcttgcggccctgaacctc
aacagtggctccagcggggcttcggatcaggatacgctggccccgctgccccacccgacc
gccccctggcccctgggtcagggctacccctaccagtacccgggacccccgccctgcttc
ccacctgcctaccaggacccgggctttagctatggcagcggcagcactgggagtcagcag
agtgaagggagcaggagtagcgggtccacccggagcagccgccgggcaccgggccgggag
aaggagcggcgggcggcgggagccgggggcagcggcagcgaatcagaccacacggcaccg
agtggggtgggcagcagctggcgggagtgtccagctggccagcttagccgcggaagcagc
ccacgcagtcaggcttcatccactgccccggggcttcccacaccccaccctgtgaccaag
gcgtatacagtggtcgggggtccacccgggggaccccctgtccgtgagctggctgccgtt
cccccggaattgacaggcagccgccagtccttccaaaaggccatggggaacccctgcgaa
ttctttgtggacatcatgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044711
Entry
101044711         CDS       T04350                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq04310  Wnt signaling pathway
sbq04330  Notch signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101044711 (DVL3)
   04330 Notch signaling pathway
    101044711 (DVL3)
   04390 Hippo signaling pathway
    101044711 (DVL3)
   04150 mTOR signaling pathway
    101044711 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101044711 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101044711 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044711 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101044711 (DVL3)
   05226 Gastric cancer
    101044711 (DVL3)
   05217 Basal cell carcinoma
    101044711 (DVL3)
   05224 Breast cancer
    101044711 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101044711 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    101044711 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101044711 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101044711 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled PDZ DEP DIX PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 101044711
NCBI-ProteinID: XP_010335931
UniProt: A0A2K6V717
LinkDB
Position
Unknown
AA seq 670 aa
MDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGG
IGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTAKGERRR
EPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSR
IERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA
ADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLP
RSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSI
HSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYA
SNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPG
AAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKE
KDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHH
THPSYGPPGVPPLYGPPMLMMPPPPTALGPPGAPPGRDLASVPPELTASRQSFRMAMGNP
TKNFGLFDFL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggacgacgatttcggagtggtgaaggaggagatctctgatgacaatgccaagctgccg
tgcttcaatggccgggtggtgtcctggctggtgtccgctgagggctcacacccagaccca
gcccccttctgtgcggacaacccgtcggagctgccaccacctatggagcgcactggaggc
atcggggactcccgacccccatccttccaccctcatgctggtgggggcagccaggagaac
ctggacaatgacacagaaacggactccttggtgtctgcccagcgagagcgtccacgccgg
agggatggcccagagcatgcagcccggctcaatggaactgcgaagggggagcggcggcga
gagccaggcggttacgacagctcatccaccctcatgagcagcgagctggagaccaccagc
ttctttgactcagatgaggatgactccaccagcaggttcagcagctccacggagcagagc
agcgcctcacgcctgatgagaagacacaagcggcggcggcggaagcagaaggtttcccgg
attgagcggtcctcatccttcagcagcatcacggactccaccatgtcactcaacatcatc
acggtcactctcaacatggaaaaatataacttcctgggcatctccattgtgggccaaagc
aacgagcgtggagacggcggcatctacatcggctctatcatgaagggcggggccgtggct
gctgacgggcgcatcgagccaggagacatgctgttacaggtaaacgagatcaactttgag
aacatgagtaatgacgacgcagtccgagtactgcgggagattgtgcacaaaccggggccc
atcaccctgactgtagccaagtgctgggacccaagtccacgtggttgcttcacgttgccc
aggagcgagcccatccggcccattgaccctgcggcctgggtctcccacactgcagccatg
acgggcaccttccctgcatatggcatgagcccctccctgagcaccatcacctccaccagc
tcctccatcaccagttctatccctgacacagagcgcctagacgacttccacctgtccatc
cacagtgacatggctgccatcgtaaaagccatggcctcccctgaatcagggttggaggtc
cgtgaccgcatgtggctcaagattaccatccctaacgctttcatcggctcagatgtggtg
gactggctataccacaatgtggaaggcttcacggaccggagggaggcccgcaagtatgcc
agcaacctgctgaaagctggcttcatccgccacaccgtcaacaagatcaccttctccgag
cagtgctactacatctttggcgacctctgcggcaacatggccaacctgtctctccacgat
cacgatggctccagtggcgcctctgaccaggacacgttggcccctttgccgcacccaggg
gccgccccttggcccatggctttcccgtaccagtacccgccacccccgcacccctacaac
ccgcacccgggcttcccagagctgggctacagctacggcgggggcagcgccagcagtcag
cacagcgaaggcagtcggagcagtggctccaaccgtagcggcagtgaccggaggaaagag
aaggacccgaaggccggggactccaagtcggggggcagcggcagcgaatcggaccacacg
acacgcagcagcctgcgggggccgcgggagcgggcgcccagcgagcgctcaggcccggcg
gccagtgaacacagccaccgcagccaccattctctggccagcagccttcgcagccaccac
acacacccgagctatggtcctcccggcgtgccccctctctacggcccccccatgctgatg
atgcccccaccgcccacggccctgggccccccaggagcccctccaggccgcgacctggcc
tcagtgcccccggaactgaccgccagcagacagtccttccgcatggccatgggaaacccc
accaagaatttcgggctgtttgactttctgtga

DBGET integrated database retrieval system