KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029000
Entry
101029000         CDS       T04350                                 

Gene name
EGLN3
Definition
(RefSeq) egl nine homolog 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101029000 (EGLN3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029000 (EGLN3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101029000 (EGLN3)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     101029000 (EGLN3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 101029000
NCBI-ProteinID: XP_003924267
UniProt: A0A2K6UID8
LinkDB
Position
Unknown
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKSESALTED
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcccctgggacacatcatgaggctggatctggagaaaatcgcgctggagtacatcgtg
ccctgtctgcacgaggtgggcttctgctacctggacaactttctgggcgaggtggtgggc
gactgcgtcctggagcgcgtcaagcagctgcactgcaccggggcccttcgggacggccag
ctggcggggccgcgcgccggcgtctccaagcgacacctgcggggagaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcagcttcctcctgtccctcatcgacagg
ctggtcctctactgcgggagccggctgggcaaatactacgtcaaggagaggtctaaggca
atggtggcttgctatccgggaaatggaacaggttatgttcgccatgtggacaaccccaac
ggcgatggtcgctgtatcacctgcatctactatctgaacaagaattgggatgccaagcta
catggcgggatcctgcggatatttccagaggggaaatcattcatagcagatgtggagccc
atttttgacagactcctgttcttctggtcagatcgcaggaacccacatgaagtgcagcct
tcttacgcgaccagatacgctatgactgtctggtacttcgatgctgaagaaagggcagaa
gctaaaaagaagttcaggaatttaactaggaaatctgaatctgctctcactgaggactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045149
Entry
101045149         CDS       T04350                                 

Gene name
EGLN2
Definition
(RefSeq) egl nine homolog 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101045149 (EGLN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045149 (EGLN2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101045149 (EGLN2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     101045149 (EGLN2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 101045149
NCBI-ProteinID: XP_010329342
UniProt: A0A2K6T8V8
LinkDB
Position
Unknown
AA seq 406 aa
MDSPCQPQPLSQALPQLPGSSSESLEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSG
TPRATATSTTASPLREGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWA
EDGGDAPSPSKRPWARQENQEAEQREGGLSCGCSSGSGEARAGLVEEVLPSAPERLALDY
IVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIA
WVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNP
HGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVK
PAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcagcccctaagtcaggctctccctcagttaccggggtct
tcgtcagagtccttggagcctggccgggccaggatgggggtggagagttacctgccctgt
cctttgctcccctcctaccactgtccaggagtgcccagtgaggcctcggcagggagtggg
acccccagagccacagccacctctaccactgccagcccccttcgggagggctttggtggg
caggatggtggtgagctgcggccgctgcagagtgaaggtgccgcagcgctggtcaccaag
gggtgccagcgactggcagcccagggtgctcggcctgaggcccccaaacggaaatgggcc
gaggatggtggggatgccccttcacccagcaagcgaccctgggccaggcaagagaaccag
gaggcagagcagcgggagggtggtttgagctgcggctgcagcagtggcagtggtgaggcc
cgcgctgggctggtggaggaggtgctgccctctgcgcctgagcgcctggccctggactat
atcgtgccctgcatgcggtactatggcatctgcgtcaaggacagcttcctgggggcagca
ctgggtggccgcgtgctggccgaggtggaggccctcaaacggggtgggcgcctgcgagat
gggcagctggtcagccagcgggcgatcccgccgcgcagcatccgtggggaccagattgcc
tgggtggaaggccatgagccaggctgccgaagcatcggagccctcatggcccatgtggat
gccgtcatccgccactgcgcagggcggctgggcagctacgtcatcaacgggcgcaccaag
gccatggtggcgtgttacccaggcaacgggctcgggtacgtaaggcatgttgacaatccc
cacggcgacggacgctgcatcacctgtatctattacctgaatcagaactgggacgttaag
gtgcatggaggcctgctgcagatcttccctgagggccggccggtggtagccaacatcgag
ccactctttgaccggttgctcattttctggtctgaccggcggaacccccacgaggtgaag
ccagcgtatgccaccaggtacgccatcactgtctggtattttgatgccaaggagcgggca
gcagccaaagacaagtatcagctagcatcaggacagaaaggtgtccaagtacctgtatca
cagccgcctacgcccacctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051675
Entry
101051675         CDS       T04350                                 

Gene name
EGLN1
Definition
(RefSeq) egl nine homolog 1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101051675 (EGLN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051675 (EGLN1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101051675 (EGLN1)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     101051675 (EGLN1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 101051675
NCBI-ProteinID: XP_003940848
LinkDB
Position
Unknown
AA seq 301 aa
MYLEKHIDHVCIWQNPQYRDEQEQPARSSLFQEKANLCPPSSAPGDALSHGGGLRPNGQT
KPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKS
DSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPG
NGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLF
FWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDV
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtacttggagaagcacattgatcatgtgtgcatctggcagaacccccagtacagagat
gagcaggagcagccggcccgctcgtcgttgttccaggagaaggcgaacctgtgccccccg
agcagcgcgcccggggatgcgctgagccacggcggcggcctgcggcccaacgggcagacg
aagcccctgccggcgctgaagctggcgctcgagtacatcgtgccctgcatgaacaagcac
ggcatctgcgtggtggacgacttcctcggcaaggagaccggacagcagatcggcgacgag
gtgcgcgccctgcacgacaccgggaagttcacggacgggcagctggtcagccagaagagt
gactcgtccaaggacatccgaggcgataagatcacctggatcgagggcaaggagcccggc
tgcgaaaccattgggctgctcatgagcagcatggacgacctgatccgccactgtaacggg
aagctgggcagctacaaaatcaatggccggacgaaagccatggttgcttgttatccgggc
aatggaacgggttatgtacgtcatgttgataatccaaatggagacggaagatgtgtgaca
tgtatatattatctaaataaagactgggatgccaaggtaagtggaggtatacttcgaatt
tttccagaaggcaaagcccagtttgctgacattgaacccaaatttgatagactgctgttt
ttctggtctgaccgtcgcaaccctcatgaagtacaaccagcatatgctacaaggtacgca
ataactgtttggtattttgatgcagatgagagagcacgagctaaagtaaaatatctaaca
ggtgaaaaaggtgtgagggttgaactcaataaaccttcagattcagttggtaaagacgtc
ttatag

DBGET integrated database retrieval system