KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029011
Entry
101029011         CDS       T04350                                 

Definition
(RefSeq) sterol 26-hydroxylase, mitochondrial
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101029011
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101029011
  09154 Digestive system
   04979 Cholesterol metabolism
    101029011
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101029011
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     101029011
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP27 family
   101029011
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101029011
NCBI-ProteinID: XP_003925570
UniProt: A0A2K6V2I0
LinkDB
Position
Unknown
AA seq 531 aa
MAALGCARLRWALRGAGRGLCPLGARAKAAIPAALPVDKAAEAPGTGPGDRRRLRSLDEI
PRLGQLRFLFQLFAQGYALKLHKLQVLYKAKFGPMWISNMGPQMHVNLASAPLVEQVMRQ
EGKYPVRNDMELWKEHRDLQDLTYGPFTTEGHHWYQLRQALNQRMLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESATGNQVSDMAQLFYYFALEAICYILFEKRIGCLERSIPEDTVTF
VRSVGLMFQNSLYATFLPKWTRSVLPFWKRYLDGWNVIFSFGKKLIDEKLKEVETQLQVA
GPDGVQVSGYLHFLLTSGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKHPEIQAA
LHEEVVGVVPAGQVPQYKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKETEVDGFLFPK
NTQFVFCHYVVSRDPDTFSDPESFQPRRWLRNSQPATLRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIRKYQVVLAPETGEVKSVARIVLVPSKKVGLQFLQRQC
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgcggggggccggccgtggcctc
tgcccccttggggccagagccaaggccgcgatccctgcagccctcccggtggataaggcc
gctgaagctcccggaaccggacctggtgaccggcggcggctacggagcttagatgagatt
ccacgtctagggcagctgcgcttcctcttccagctgtttgctcaaggttacgccttgaag
ctgcacaagttacaggtgctttacaaggccaagtttggtccgatgtggatatccaacatg
gggcctcagatgcacgtgaacctggccagtgccccactcgtggagcaagtgatgcggcaa
gagggcaagtacccagtacggaatgacatggagctgtggaaggagcaccgggacctgcaa
gacctcacctatgggccattcaccacggaaggacaccactggtaccagctgcgccaggct
ctgaaccagcggatgctgaagccagcagaggcagcgctctatacagatgctttcaatgag
gtgattgatgactttatgactcgactggatcagctgcgggcggagagtgctacggggaac
caggtgtcagacatggctcaactcttctactactttgccttggaagctatttgctacata
ctgtttgaaaaacgcattggctgcctggagcgatccatccccgaggacaccgtgaccttc
gtcagatccgtcgggctcatgttccagaattcactctatgccaccttcctccccaagtgg
actcgctccgtgctgcctttctggaagcgatacctggatggttggaatgtcatcttctcc
tttgggaagaagctgattgatgagaaactcaaggaagtggagacccagctgcaggtagcg
gggccagatggcgtccaggtgtctggctacctgcatttcctgctgaccagtggacagctc
agccctcgggaggccatgggaagcctgcctgagctgctcatggctggagtggacacgaca
tccaacacgctgacatgggccctgtaccacctctcaaagcatcctgagatccaggcggcc
ttgcatgaggaagtggtgggtgtggtgccagctggccaggtgccccagtacaaggacttt
gcccacatgcccttgctcaaagctgtgcttaaggagactctgcgcctctaccctgtggtc
cccacaaattcccggatcatagaaaaggaaactgaagttgatggcttcctcttccccaag
aatacccaatttgtgttctgccactacgtggtgtcccgggaccctgacaccttctctgac
cctgagagcttccagccccgccgctggctgagaaacagccagcctgctaccctcagaatc
cagcacccatttggctccgtgccctttggttatggggtgcgggcctgcctgggccgcagg
attgcagagctggaaatgcagctactcctggcaaggctgatccggaagtaccaggtggtc
ctggccccggagacgggagaggtgaagagtgtggcccgcattgtcctggttcccagtaag
aaagtgggcctgcagttcctgcagagacagtgctaa

DBGET integrated database retrieval system