KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029045
Entry
101029045         CDS       T04350                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04110  Cell cycle
sbq04137  Mitophagy - animal
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101029045 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    101029045 (E2F1)
   04218 Cellular senescence
    101029045 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029045 (E2F1)
   05206 MicroRNAs in cancer
    101029045 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101029045 (E2F1)
   05225 Hepatocellular carcinoma
    101029045 (E2F1)
   05226 Gastric cancer
    101029045 (E2F1)
   05214 Glioma
    101029045 (E2F1)
   05220 Chronic myeloid leukemia
    101029045 (E2F1)
   05218 Melanoma
    101029045 (E2F1)
   05219 Bladder cancer
    101029045 (E2F1)
   05215 Prostate cancer
    101029045 (E2F1)
   05224 Breast cancer
    101029045 (E2F1)
   05222 Small cell lung cancer
    101029045 (E2F1)
   05223 Non-small cell lung cancer
    101029045 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101029045 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101029045 (E2F1)
   05161 Hepatitis B
    101029045 (E2F1)
   05160 Hepatitis C
    101029045 (E2F1)
   05163 Human cytomegalovirus infection
    101029045 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029045 (E2F1)
   05169 Epstein-Barr virus infection
    101029045 (E2F1)
   05165 Human papillomavirus infection
    101029045 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101029045 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101029045 (E2F1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101029045 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101029045
NCBI-ProteinID: XP_003932172
LinkDB
Position
Unknown
AA seq 376 aa
METAQQPTGEVAVAVVMRCSWQLHVKRRLDLETDHQYLAESSGPARGRGRHQGKGVKSPG
EKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKK
SKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRL
AYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEETV
GGISPGKTPSPSQEATSVEENRATDSATIVPPPSSSPSSSFATDPSQSLLSLEQEPLLSR
MGSLRAPMDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEGLDYHFGLEEGEGI
RDLFDCDFGDFTPLDF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagactgctcaacagcccacaggggaagtggcagtcgccgtggtgatgagatgttct
tggcagctgcatgtgaagcggaggctggacctggaaactgaccatcagtacctggctgaa
agcagtgggccagctcggggcagaggccgccatcaaggaaaaggtgtgaaatccccgggg
gagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctggaactgctg
agccgctctgctgacggcgttgtcgacctgaactgggctgccgaggtgctcaaagtgcag
aagaggcgcatctatgacatcaccaacgtcctcgagggcatccagctcatcgccaagaag
tccaagaaccacatccagtggctgggcagccacactacagtgggtgtcggtgggcggctt
gaggggctgacccaggacctccggcagctgcaggagagcgagcagcagctggaccacctg
atgaatatctgtactacgcagctgcgcctgctctctgaggacactgacagccagcgcctg
gcctatgtgacgtgtcaggatcttcgtagcattgcagaccctgcagagcagatggttatg
gtgatcaaggctcctcccgagacccagctccaagccgtggactcttcggagacatttcag
atctctcttaagagcaaacaaggccccatcgatgttttcctgtgccctgaggagactgtg
ggtgggatcagccctgggaagaccccgtccccatcccaggaggctacttctgtggaggag
aacagggccactgactctgccaccatagtgccaccaccatcatcatctccctcctcatcc
ttcgccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcccgg
atgggcagcctgcgggctcccatggacgaggaccgcctgtccccgctggtggcagccgac
tcgctcctggagcatgtgcgggaggacttctccggccttctccctgaggagttcatcagc
ctttccccaccccacgagggcctcgactaccacttcggcctcgaggagggcgagggcatc
agagacctcttcgactgtgactttggggacttcacccccctcgatttctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034207
Entry
101034207         CDS       T04350                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04110  Cell cycle
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101034207 (E2F3)
   04218 Cellular senescence
    101034207 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034207 (E2F3)
   05206 MicroRNAs in cancer
    101034207 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101034207 (E2F3)
   05225 Hepatocellular carcinoma
    101034207 (E2F3)
   05226 Gastric cancer
    101034207 (E2F3)
   05214 Glioma
    101034207 (E2F3)
   05220 Chronic myeloid leukemia
    101034207 (E2F3)
   05218 Melanoma
    101034207 (E2F3)
   05219 Bladder cancer
    101034207 (E2F3)
   05215 Prostate cancer
    101034207 (E2F3)
   05224 Breast cancer
    101034207 (E2F3)
   05222 Small cell lung cancer
    101034207 (E2F3)
   05223 Non-small cell lung cancer
    101034207 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101034207 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034207 (E2F3)
   05161 Hepatitis B
    101034207 (E2F3)
   05160 Hepatitis C
    101034207 (E2F3)
   05163 Human cytomegalovirus infection
    101034207 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034207 (E2F3)
   05169 Epstein-Barr virus infection
    101034207 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101034207 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101034207 (E2F3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101034207 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101034207
NCBI-ProteinID: XP_010336317
LinkDB
Position
Unknown
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTSN
QDHNGNIPKPTSKDLASTNSGHSDCSISMGNLSPLASPSNLLQQTEDQIPSSLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFEAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactacgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacgcggtatgatacgtcccttggtctg
ctcaccaagaagttcattcagctcctgagccagtcacccgatggggtcttggatttgaac
aaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgatatcaccaacgttctg
gaaggcatccacctcattaagaagaagtctaaaaacaacgtccaatggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgactcaatagagagcctacaaatacatttggcaagtacccaaggaccc
attgaggtttacctatgtccagaagagactgaaacacacagtccaatgaaaacaagcaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagcgattgctccatttctatgggaaacctttctcctctggcctccccatccaac
ctcttacagcagactgaggaccaaattccttccagcctagaagggccgttcgtgaactta
ctgcctcccctgctgcaagaggactatctcctgagcctgggggaggaggaaggcatcagc
gatctctttgaagcttatgatttggaaaagctcccactggtggaagacttcatgtgtagc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042612
Entry
101042612         CDS       T04350                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04110  Cell cycle
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101042612 (E2F2)
   04218 Cellular senescence
    101042612 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101042612 (E2F2)
   05206 MicroRNAs in cancer
    101042612 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101042612 (E2F2)
   05225 Hepatocellular carcinoma
    101042612 (E2F2)
   05226 Gastric cancer
    101042612 (E2F2)
   05214 Glioma
    101042612 (E2F2)
   05220 Chronic myeloid leukemia
    101042612 (E2F2)
   05218 Melanoma
    101042612 (E2F2)
   05219 Bladder cancer
    101042612 (E2F2)
   05215 Prostate cancer
    101042612 (E2F2)
   05224 Breast cancer
    101042612 (E2F2)
   05222 Small cell lung cancer
    101042612 (E2F2)
   05223 Non-small cell lung cancer
    101042612 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101042612 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101042612 (E2F2)
   05161 Hepatitis B
    101042612 (E2F2)
   05160 Hepatitis C
    101042612 (E2F2)
   05163 Human cytomegalovirus infection
    101042612 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101042612 (E2F2)
   05169 Epstein-Barr virus infection
    101042612 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101042612 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101042612 (E2F2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101042612 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101042612
NCBI-ProteinID: XP_003934925
UniProt: A0A2K6UQU1
LinkDB
Position
Unknown
AA seq 437 aa
MLRGPRILASATGQHPKVVPAMSPTELWPPGLSSPQLCPATTTYYTPLYPQTAPPAAAPG
TCLDATPHGSEGQVVRCLPAGRLPAKRKLDLEGIGRPAVLEVPTSKGKFIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNREQVLDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVSNFKEQTVIAVKAPPQTRLEVPDRNEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLSPSPDSAQPSSSTDPSIMEPTASSVPAPAPIPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccggatcttggcttcggccactgggcagcacccgaaggtggtgccc
gcgatgagccccaccgagctgtggccgcccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgctgcggcgcccggc
acctgcctcgacgccactccccatggatccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgctgtgctt
gaggtcccaacctccaaggggaagttcatcagagtggatggcctccccagccccaaaacc
cccaaatctcccggggagaagactcgatatgacacctcgctggggctgctcaccaagaag
ttcatttaccttctgagcgagtcggaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctagagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacagg
gagcaggtcctggaccagctcatccagagctgctctctgagctttaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcagcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggaatgaggacaatctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgtccagaggaggtgcaggagccagacagtccttctgaggagcccctgccttct
acctctaccctcagccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccgatcccccagcaggcccca
ccgcctccatccctggtgcccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagaccgaggaccaattcctgtccccaaccctggcatgcagctcccctctg
atcagcttctcaccgtccttggaccaggatgactacctgtggggcctggaggcgggtgag
ggcatcagtgacctcttcgactcctacgacctcggggacctgttgattaactga

DBGET integrated database retrieval system