KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029076
Entry
101029076         CDS       T04350                                 

Gene name
TCF7
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7
  KO
K02620  transcription factor 7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05132  Salmonella infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101029076 (TCF7)
   04390 Hippo signaling pathway
    101029076 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101029076 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    101029076 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101029076 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029076 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101029076 (TCF7)
   05225 Hepatocellular carcinoma
    101029076 (TCF7)
   05226 Gastric cancer
    101029076 (TCF7)
   05216 Thyroid cancer
    101029076 (TCF7)
   05221 Acute myeloid leukemia
    101029076 (TCF7)
   05217 Basal cell carcinoma
    101029076 (TCF7)
   05215 Prostate cancer
    101029076 (TCF7)
   05213 Endometrial cancer
    101029076 (TCF7)
   05224 Breast cancer
    101029076 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101029076 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101029076 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101029076 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029076 (TCF7)
   05165 Human papillomavirus infection
    101029076 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101029076 (TCF7)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101029076 (TCF7)
SSDB
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2 Peptidase_M13
Other DBs
NCBI-GeneID: 101029076
NCBI-ProteinID: XP_010337029
LinkDB
Position
Unknown
AA seq 381 aa
MYKETVYSAFNLLMHYPPPSGAGQHPQPQPTLHKASQPAHGVPQLSPLYEHFNSPHPTPA
PVDISQKQVPRPLQTPDLSGFYSLTSSSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHP
TIVPPSGKQELQPYDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLK
ESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQ
ESTTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRYPSPVPYDDSALGCPRS
PAPQDSPSYHLLPHFPTELLASPAEQHLHPQISPLLSASQPQGPHRPPAAPCRVHRYSNR
NLRDRRPSRYRTPGLLQEPTP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtacaaagagaccgtctactccgccttcaatctgctcatgcactacccacccccctcg
ggagcagggcagcacccccagccgcagcccacgctgcacaaggccagtcagcctgcccat
ggtgtcccccaactctctcctctctacgaacatttcaacagcccacaccccacccctgca
cctgtggacatcagccagaaacaagttcctaggcctctgcagacccctgacctctctggc
ttctactccctgacctcaagcagcatgggacagctcccccacactgtgagctggttcacc
cacccatccttgatgctcggctctggtgtacctggtcacccagcagccattccccacccc
acaattgtgcccccctcagggaagcaggagctgcagccctacgaccgcaacctgaaaaca
caagcagagtccaaagcagagaaggaggctaagaagccaaccatcaagaagcccctcaat
gctttcatgctgtacatgaaggagatgagagccaaggtcatcgcagagtgcacacttaag
gagagcgctgccatcaaccagatcctgggccgcaggtggcacgcgttgtctcgagaagag
caggccaagtattatgagctggcccgcaaggaaaggcagctgcacatgcagctttaccca
ggctggtcggcgcgggacaactacgggaagaagaagaggagatcgagggaaaagcaccaa
gaatccaccacagaccctggctcgcctaagaaatgccgtgctcgctttggcctcaaccag
cagacggattggtgtggtccgtgcaggaggaaaaagaaatgcattcggtacttacccgga
gaaggccgctaccccagccccgttccttacgatgacagtgctctaggctgccccaggtcc
ccagctccccaggactcaccctcataccatctgctgccccactttcccacagaactgctt
gctagccctgcggagcagcacctacatccccagatctctccactgctctcagcctcccag
ccccagggcccccacaggccccccgcagcaccttgcagagtacacaggtacagcaacagg
aatctcagagacaggcggcctagcaggtacaggacacctggcctcctccaggagcctacc
ccctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033762
Entry
101033762         CDS       T04350                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05132  Salmonella infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101033762 (TCF7L1)
   04390 Hippo signaling pathway
    101033762 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101033762 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101033762 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033762 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101033762 (TCF7L1)
   05225 Hepatocellular carcinoma
    101033762 (TCF7L1)
   05226 Gastric cancer
    101033762 (TCF7L1)
   05216 Thyroid cancer
    101033762 (TCF7L1)
   05221 Acute myeloid leukemia
    101033762 (TCF7L1)
   05217 Basal cell carcinoma
    101033762 (TCF7L1)
   05215 Prostate cancer
    101033762 (TCF7L1)
   05213 Endometrial cancer
    101033762 (TCF7L1)
   05224 Breast cancer
    101033762 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101033762 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101033762 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101033762 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101033762 (TCF7L1)
   05165 Human papillomavirus infection
    101033762 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101033762 (TCF7L1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101033762 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 101033762
NCBI-ProteinID: XP_010328292
LinkDB
Position
Unknown
AA seq 497 aa
MALLNQMLELGIQVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLSNGPLSPGGARTYLQM
KWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTHL
SPEIDPKTGIPRPPHPTELSPYYPLSPGAVGQIAHPLGWLVPQQGQPMYSLPPGGFRHPY
PALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAK
SPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREE
QAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKS
KKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPET
RAHLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQA
LPVLQAQPLSLVTKSAH
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggcgttgcttaatcagatgttagaacttggaattcaagtgagaaggccccaggacggc
gcgttctttaaaggacccccctaccctgggtaccccttcctgatgatcccggacctgagt
agcccgtacctctccaacggacccctgtctcccggaggagcgcgcacctatctgcagatg
aaatggcccctcctcgatgtcccctccagtgccacagtcaaggacacgaggtcaccatct
ccagcacacttgtctaacaaagttcctgtcgttcagcacccacatcacatgcatccgctg
actcccctcatcacctacagcaatgaccacttctcccccggctccccgcccactcacctc
tccccagagatcgatccaaagacaggaatcccgcggcctcctcacccaaccgagctgtca
ccgtattacccgctgtctcctggagctgtcggacaaatcgcccacccccttggctggctc
gtgccacagcaaggccagcccatgtactctcttcctcctggtggcttccggcacccttac
cctgccctcgccatgaatgcgtcaatgtccagcctggtctccagtcggttctcacctcac
atggtggctcctgcccaccctggcctgcccacctcagggatcccccaccccgccatcgtc
tcccccatcgtcaagcaggaaccggcaccacccagcctgagccctgcggtgagcgcgaaa
tcaccagtcaccgtgaaaaaggaggaggaaaagaagccccacgtgaagaagcctctgaat
gccttcatgttgtatatgaaggagatgagggccaaggtggtggccgagtgcaccctgaag
gaaagtgcagccattaaccagatcctgggaagaaagtggcacaacctgtctcgagaagaa
caggccaagtactacgagctggctcggaaggagcggcagcttcactcgcagctctacccg
acctggtcagcccgggacaactacggtaagaaaaagaagaggaagagagaaaagcagctg
tcccagacacagtcacagcagcaagtccaggaggcagaaggtgctctggcctccaaaagc
aagaagccatgtgttcagtacctgccccccgagaagccctgtgacagccctgcctcctcc
cacggcagcatgctggactctccggccaccccctctgcagctttggcctcaccagccgcc
cctgctgccacccattcggagcaagcccagcccctctccctcaccaccaagccagaaacc
cgggcccatctggctctccactccgctgccttcctgtccgctaaggctgcagcctcctcc
tctgggcagatgggcagccagcctcccctcctatcccggcccctcccacttgggtccatg
cccacagctctgctggcctctcccccgtccttccctgccacgctccatgcccaccaggcc
ctcccggtgctacaggcccagcctctttccttggtcaccaagtctgcccactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037011
Entry
101037011         CDS       T04350                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2
  KO
K04491  transcription factor 7-like 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05132  Salmonella infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101037011 (TCF7L2)
   04390 Hippo signaling pathway
    101037011 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101037011 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101037011 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101037011 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101037011 (TCF7L2)
   05225 Hepatocellular carcinoma
    101037011 (TCF7L2)
   05226 Gastric cancer
    101037011 (TCF7L2)
   05216 Thyroid cancer
    101037011 (TCF7L2)
   05221 Acute myeloid leukemia
    101037011 (TCF7L2)
   05217 Basal cell carcinoma
    101037011 (TCF7L2)
   05215 Prostate cancer
    101037011 (TCF7L2)
   05213 Endometrial cancer
    101037011 (TCF7L2)
   05224 Breast cancer
    101037011 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101037011 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101037011 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101037011 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101037011 (TCF7L2)
   05165 Human papillomavirus infection
    101037011 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101037011 (TCF7L2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101037011 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101037011
NCBI-ProteinID: XP_010331657
LinkDB
Position
Unknown
AA seq 689 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEDWSHRKLGGSEEPFSLPTRRAASALGAVAGSAARC
AGCGLFWAARGSGAERGGEAPAARLPCRPFVGPGGARDQGVRAQGGAGAEGGGAPILPGS
GSPIAGQPTLWAPGQRGVPGPGGASCSVRPAPNPDLHFQSGSTHYSAYKTIEHQIAVQYL
QMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFT
PGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPIT
TGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLH
SSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALS
REEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNDANTPKKCRALFG
LDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSIA
QPSTSSLHSHSSLAGTQPQPLSLVTKSLE
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctgggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcggagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagattggtcccaccgcaaacttgggggctctgaggagcccttttct
ttgccaacccgcagggccgcgagcgccctgggcgcggtggcgggctcggctgcccggtgc
gctggctgcgggctcttctgggccgcgcggggcagcggggcagagcggggcggggaggcc
cctgcggcccggcttccgtgtaggcccttcgtgggccctggaggggccagagaccagggt
gtgcgggctcaaggaggtgcaggggccgagggaggcggggcgcctatccttccagggagt
gggtcgccgatcgccggccagccaactttgtgggccccagggcagcgcggggtgccgggc
cccgggggcgcttcctgcagcgtccgtcccgcgcccaaccctgacctccattttcagtcc
ggcagcacacattactctgcgtacaaaacgattgaacaccagattgcagttcagtatctc
cagatgaaatggccactgcttgatgtccaggcaggaagcctccagagcagacaagccctc
aaagatgcccgctccccctcgccagcacacatcgtctcgaacaaagtgccggtggtgcag
caccctcaccatgtccaccccctcacgcctcttatcacgtacagcaatgaacacttcacg
ccgggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatccccgtattacccgctatcacctggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcaaccagtgtacccaatcaca
acaggaggattcagacacccctaccccacagctctgaccgtcaatgcttccatgtccagg
ttccctccccatatggtcccaccacatcatacgctacacacgacgggcattccgcatccg
gccatagtcacgccaacagtcaaacaggaatcgtcccagagtgacgtcggctcactccat
agctcaaagcatcaggactccaaaaaggaagaagaaaagaagaagccccacataaagaaa
cctcttaatgcattcatgttgtatatgaaggaaatgagagcaaaggtcgtagccgagtgc
acattgaaagaaagcgcggccatcaaccagatccttgggcggaggtggcatgcactgtcc
agggaagagcaagcgaaatactacgagctggcccggaaggaacgacagcttcatatgcaa
ctgtaccccggctggtctgcgcgggataactatgggaagaagaagaagaggaaaagggac
aagcagccgggagagaccaatgatgcaaatactccaaagaagtgtcgggcactgttcggg
cttgaccgacagactttatggtgcaaaccgtgcaggagaaaaaaaaagtgcgttcgctac
atacaaggtgaaggcagctgcctcagcccaccctcttcagatggaagcttactagattcg
cctcccccctcccccaacctgctaggctcccctccccgagacgccaagtcacagactgag
cagacccagcctctgtcgctgtccctgaagcctgaccccctggcccacctgtccatgatg
cctccgccgcccgccctcctgctcgctgaggccacccacaaggcctccgccctctgtccc
aacggggccctggacctgccccccgccgctctgcagcccgccgccccctcatcaattgca
cagccgtcgacttcttccttacattcccacagctccctggccgggacgcagccccagccg
ctgtcgctcgtcaccaagtctttagaatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047688
Entry
101047688         CDS       T04350                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04916  Melanogenesis
sbq04934  Cushing syndrome
sbq05132  Salmonella infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101047688 (LEF1)
   04390 Hippo signaling pathway
    101047688 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101047688 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101047688 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047688 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047688 (LEF1)
   05225 Hepatocellular carcinoma
    101047688 (LEF1)
   05226 Gastric cancer
    101047688 (LEF1)
   05216 Thyroid cancer
    101047688 (LEF1)
   05221 Acute myeloid leukemia
    101047688 (LEF1)
   05217 Basal cell carcinoma
    101047688 (LEF1)
   05215 Prostate cancer
    101047688 (LEF1)
   05213 Endometrial cancer
    101047688 (LEF1)
   05224 Breast cancer
    101047688 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101047688 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047688 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101047688 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047688 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101047688 (LEF1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101047688 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101047688
NCBI-ProteinID: XP_003929516
UniProt: A0A2K6TYR2
LinkDB
Position
Unknown
AA seq 303 aa
MAEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSN
GSLSPPMPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHP
PAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTD
SDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRR
WHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTA
AYI
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcagaggtggccagacaagcacaaacctctcaggagtcctaccatgacaaggccaga
gaacaccctgatgacggaaagcatccagatggaggcctctacaacaagggaccctcctac
tcgagttattctgggtacatcatgatgccaaatatgaataatgacccatacatgtcaaat
ggatctctttctccacctatgccgagaacatcaaataaagtgcccgtggtgcagccatcc
catgcggtccatcctctcactcccctcatcacttacagcgacgagcacttttctccagga
tcacacccatcacacatcccatcagatgtcaactccaaacaaggcatgtccagacatcct
ccagctcctgatatccctactttttatcctctgtctcctggtggtgttggacagatcacc
ccacctcttggctggttttcccatcacatgatccccggtcctcctggtccccacacaact
ggcatccctcatccagctattgtaacacctcaggtcaaacaagaacatccacacacggac
agtgacctaatgcacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaaga
cctcacattaagaagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaat
gtcgtcgctgagtgtactctaaaagaaagtgcagctatcaaccagattctcggcagaagg
tggcatgccctctcccgtgaagagcaggctaaatattatgaactagcacggaaagaaaga
cagctacatatgcagctttatccaggctggtctgcaagagacaattatggtaagaaaaag
aagaggaagagagagaaactacaggaatctacatcaggtacaggtccaagaatgacagct
gcctacatctga

DBGET integrated database retrieval system