KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029174
Entry
101029174         CDS       T04350                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101029174 (RALGDS)
   04015 Rap1 signaling pathway
    101029174 (RALGDS)
   04072 Phospholipase D signaling pathway
    101029174 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029174 (RALGDS)
   05231 Choline metabolism in cancer
    101029174 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101029174 (RALGDS)
   05212 Pancreatic cancer
    101029174 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 101029174
NCBI-ProteinID: XP_010344711
LinkDB
Position
Unknown
AA seq 937 aa
MAREAGQVCARPAVPRGRKGSVFFACVSVVTARQRAVARRAALRSPTPWLVPLPAPATTE
SSTQEIGEELINGVIYSISLRKVQLHHGANKGQRWLGYENESALNLYETCKVRTVKAGTL
EKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILP
YSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRA
HLLLAQLEHSEPTEAEPEALSPVPALKPAPAPAPARAPSPAPAPVPEPAPASELEPAPAP
APAPSPAPSPAPAPEPAPIPASASELEVAPAPAQELPRAPAPAPELEPAPAPAPEQEPAP
PAERDPAPSQTPELEPALAPVPSPEPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLM
DAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGDRSTKAP
DRARVVEHWIEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSFRIFQKLSE
IFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVML
DTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDERFGAWFRAVQRLSEAE
SYNLSCELEPPSESASNTLKTKKNAAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPY
LSSGDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASS
STSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSI
LVTSQDKAPAVIRKAMDKHHLDADEPEDYELVQILSDDRKLKIPENANVFYAMNSTANYD
FVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
NT seq 2814 nt   +upstreamnt  +downstreamnt
atggcccgggaagcaggccaggtttgtgccaggcctgctgtgcccagggggaggaagggc
tccgtgttctttgcctgtgtctctgtggtgaccgccaggcagagggccgtggcccgccgt
gctgctctccgaagcccgacaccttggctggtacctctgccagcaccggccaccacggag
agctctacgcaggagatcggtgaggagctgatcaacggagtcatctactccatctccctg
cgcaaggtgcagctgcaccacggagctaacaagggccagcgctggctcgggtatgagaac
gagtcggctctgaacctttatgagacttgcaaggtgcggactgtgaaggctggcacactg
gagaagctggtggagcacctggtgcctgccttccaaggcagcgacctctcctacgtcacc
atcttcctgtgtacctacagagccttcaccaccacccagcaggtcctggacctgctgttc
aaaaggtacggtagatgtgacgccctcacggcctcctctagatacggatgcatcctcccc
tactccgatgaggatggtggaccccaggaccaacttaaaaatgccatctcctccatcctg
ggcacctggctggaccagtactcggaggatttctgtcaacccccggacttcccctgcctc
aagcagctggtggcctacgtgcagctcaacatgccaggctcagacctggagcgccgtgcc
cacctcctcctggcccagctggagcactcagaacccactgaggcagagcctgaggctctg
tcaccagtgccagctctaaaaccagctcctgctccagcaccagctcgagcacccagccca
gcaccagccccagtgccggagccagctccagcttcagagctagagccagctccagcacca
gctccagcacccagcccagcacccagcccagcaccagccccagagccagctccaatacca
gcttcagcttcagagctagaggtagctccagcaccagctcaggagctcccgcgggctccg
gcaccagctccagaactagaaccggctccagcaccagctccagaacaagagccagcaccg
cctgcagaacgggatccggctccctcacaaactccagagctggagcctgctctggcacca
gtcccatcaccagagccttcctggccttcgcctgtggttgcagagaacggactgagcgag
gagaagcctcacctcttggtgttccctcctgacctggtggcggagcagtttacactgatg
gatgcggagctgttcaagaaggtggtaccctaccactgcctgggctccatctggtcccag
cgggacaagaagggcaaggagcacctggcacccaccatccgtgccaccgtcacccagttc
aacagcgtggccaactgcgtcatcaccacctgccttggggaccgaagcacgaaggcccca
gacagggccagggtggtggagcactggatcgaggtggccagggagtgccgggtcctcaag
aacttctcatcactctatgccatcctctctgctctgcagagtaactccatccaccgtctg
aagaagacgtgggaagaagtttccagggacagcttccggatctttcagaagctgtcagag
atcttctcagatgagaacaactactcactaagccgggagctgctcatcaaggaggggacc
tccaagtttgctaccctggagatgaaccccaagagagcccagaaacggccgaaggaaacg
ggcatcatccagggcaccgttccctacctgggcacgttcctcactgacctagtgatgctg
gacaccgccatgaaggactatctgtatggcagactcatcaacttcgagaagaggaggaag
gagttcgaggtgatcgcccagatcaagctgctgcagtcggcttgtaacaactacagcatc
gcgcccgacgagcggtttggggcctggttccgggcggtgcagcggctcagcgaggctgag
agctacaacctgtcgtgtgagctggagcccccatccgagtcagccagcaacaccctcaag
accaagaagaacgcagccattgtcaagcgctggagcgatcgccaggcccccagcactgag
ctcagtaccagcggtagctcccactccaagtcctgtgaccagcttaggtgtggcccctac
ctcagcagcggggacatcgctgatgcactcagcgtgcactcggccggctcctccagctcc
gacgtggaggagatcaacatcagcttcgtcccggagtcccctgatggccaggaaaagaag
ttctgggaatcagcctcacagtcgtccccggagacctctggcatcagctcggcctccagc
agcacctcgtcctcctcagcctccaccacacccgtggctgccacgcgcacccacaagcgc
tccgtctcagggctctgcaactccagctccgcgctgccgctctacaaccagcaggtgggc
gactgctgcatcatccgtgtcagcctggatgtggacaacggcaacatgtacaagagcatc
ctggtgaccagccaagataaggctccggccgtcatccgcaaggccatggacaaacaccac
ctggacgcggatgagccggaggactatgagctggtgcagattctctcagatgaccggaag
ctgaagatccctgaaaacgccaacgtgttctatgccatgaattctaccgccaactatgac
tttgtcctgaagaagcggaccttcaccaagggggtgaaggtaaagcatggagccagctcc
accctccctcgcatgaagcagaaaggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system